SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010905 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010905
Domain Number 1 Region: 54-177
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000126
Family Spermadhesin, CUB domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010905   Gene: ENSLAFG00000013037   Transcript: ENSLAFT00000013036
Sequence length 322
Comment pep:novel supercontig:loxAfr3:scaffold_7:80041746:80053930:1 gene:ENSLAFG00000013037 transcript:ENSLAFT00000013036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTFKLQCHFILIFLMAPRGDSRSLELREAADYDPFLLFSANLKRELAGEQLYRRALRC
VDMLSLQGQFTFTANQPQLHCAAFFIGEPEEFITIHYDLVSIDCQGGDFLKVFDGWILKG
EKFPSSQDHPLPMTERYIDYCENGLSRRSVRSSQNVAMIFFRVQEPGNGFTLTIKTDPNL
FPCNVISQTPNGRFTLVVPHQHRNCSFSIIYPVAIKISDLTLGHLNGLQLKKSSAGCGGV
GDFVELLGGAGLDPSKMMPLADLCYPFHGPAQMKIGCDNTVVRMVSSGKHINRVTFEYRL
LQPYELENPNGNSIREFCLSHL
Download sequence
Identical sequences G3TAJ8
XP_003408013.1.64505 ENSLAFP00000010905 ENSLAFP00000010905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]