SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011076 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLAFP00000011076
Domain Number - Region: 277-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000258
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 246-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000342
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 181-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00115
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 214-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0017
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 310-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00901
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011076   Gene: ENSLAFG00000013238   Transcript: ENSLAFT00000013238
Sequence length 379
Comment pep:novel supercontig:loxAfr3:scaffold_2:54716864:54799778:-1 gene:ENSLAFG00000013238 transcript:ENSLAFT00000013238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRRSAFPAAALRLWSILPCLLVLRAEAGQPREESLYLWIDAHQARVLIGFEEDILIVSE
GKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN
VPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILQTPQNAIFFKTCQQA
ECPGGCRNGGFCNERRVCQCPDGFYGPHCEKALCTPWCMNGGLCVTPGFCICPPGFYGVN
CDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGY
QGDLCSKPVCEPGCGTHGTCHEPNKCQCQEGWHGRHCNKRYGASLVHALRPAGAGLGQHT
PSLKKPEEGQDPPESNYIW
Download sequence
Identical sequences G3TAY0
ENSLAFP00000011076 ENSLAFP00000011076 XP_003405228.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]