SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011243 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011243
Domain Number 1 Region: 2109-2235
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-35
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 2 Region: 344-459
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-34
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 3 Region: 579-687
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-33
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 4 Region: 10-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-33
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 5 Region: 123-232
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-33
Family Spermadhesin, CUB domain 0.00069
Further Details:      
 
Domain Number 6 Region: 692-802
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-33
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 7 Region: 1407-1520
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-32
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 8 Region: 1183-1289
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-32
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 9 Region: 1644-1755
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-32
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 10 Region: 1992-2104
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.1e-31
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 11 Region: 2350-2462
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-31
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 12 Region: 1292-1403
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-31
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 13 Region: 232-341
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-30
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 14 Region: 463-571
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-30
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 15 Region: 1871-1993
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-28
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 16 Region: 2466-2577
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-28
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 17 Region: 811-917
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-28
Family Spermadhesin, CUB domain 0.00098
Further Details:      
 
Domain Number 18 Region: 932-1044
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-26
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 19 Region: 1047-1168
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-25
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 20 Region: 1526-1642
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-24
Family Spermadhesin, CUB domain 0.00093
Further Details:      
 
Domain Number 21 Region: 1760-1873
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-21
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 22 Region: 2243-2347
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-16
Family Spermadhesin, CUB domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011243   Gene: ENSLAFG00000013402   Transcript: ENSLAFT00000013433
Sequence length 2579
Comment pep:novel supercontig:loxAfr3:scaffold_15:27857990:28103525:1 gene:ENSLAFG00000013402 transcript:ENSLAFT00000013433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TACLQDYTMESGTFTSPNFPSNYPNNWECIYRITVGTSKQIALHFTNFSLEEAIGQCVDL
VEIRDGGYENSPSLGIYCGSNPPPRIISHSNKLWIRFKSDLFDSRSGFSAYWDGSATGCG
GNLTTPSGVFTSPNYPMPYYHSSECYWWLKSSHGSPFELEFENFHLEQHPNCTLDYLAVY
DGPSTSSHLRTQLCGDQKPPLIRSSGDSMSLKMRTDEGQQGGGFLASYRQICENVIIVNQ
TYGILESIDYPNPYYANQRCNWTIQATKGNTVNYTFSAFELEDHINCSTDYLELYDGSRR
MGRYCGTDIPPPGSTTGSKLRVLFYTDGVGNREKGFQMQWFIHGCGGELSGDIGSFSSPG
YPNRYPPNKECIWYIKTAPGTSIQLTIHDFDVEYHASCNYDSLEVYGGPDFHSPRIAQLC
AQRSSENPMQVSSTGNELAIRFKTDSSINGRDFNISWKANVIGCGGIFKTPSGEIHSPNY
PSPYRSNTECSWVIQVERNYRVLLNFTDIDLEPQDSCITAYDGLNTATTRLASVCGRQQL
TNPITSSGNALFVRFQSGASSQSRGFRARFSQACGSVLLTNSFDTISSPFFPAKYPSSQN
CSWIIQAQPPFNHITLSFSHFELESSTACSRDFLEILDGSDYDAPLRGRYCGISMPHPIT
SFSNALTLRFVSDSRVNSVGFHASYAASSSACGGTFHMAEGTFNSPGYPEVYPSNVECVW
NIVSSPGNQLQLSFITFQLEDSQDCSRDFVEIREGNATGHLVGRYCGHVLPLNYSSIVGH
ILWVRFVSDGSGSDTGFQATFVNIFGNDNIVGTHGKIASPLWPGNYPHNSNYQWIVNVNA
SQVIHGRILEMNIEATYNCYYDKLRVFDGLGIHSRQIGTYCGTQSASFSSSRNSLTFQFS
SDSSISGKGFLLEWFAVGAPVGPLPTIATGACGGLVRTGDTPVFLFSPGWPGSYSNWADC
TWIIQAPDSTVEFNILSLDIESHQTCDFDKLVIRDVIGDSNLAQELAVLCGREIPGPIRS
TGEYMLIRFTSDFSVTGAGFNASFHKSCGGYLHADRGVITSPMYPEAYPPSLNCSWHVLV
QSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLKNGPDIYSPPLGPHGGNGHFCGSHPSSTM
FTSDNEMFAQFISDNSNGGQGFKIKYEAKSLACGGNIYIRDDDSAGYVTSPNHPNNYPQH
ADCVWILSAPPEKSVQLQFEDQFYIEATPNCTSNYLELRGGADSNAPVLSKFCGTSLPSS
QLSSEEVMYLRFRSDNSPTHVGFKAKYSIALCGGTVTGQSGIIESIGYPTLPYRDNLFCE
WHLQGLSGHYFTIYFEDFNLQNSSNCEKDFVEIWENHISGHVLGRFCGNTIPDSIDTSGN
VALVKFVTDGSLTASGFRLRFESSMDECGGDLQGPTGTFTSPNYPNPNPHSRICEWKIAV
QEGRRITLTFNNLRLEAHPSCSNEHVTVFNGIRSNSPQLEELCSSVNVSDQIKSSGNTMK
VVFFTDGSRPYGGFIASYTSSEDAVCGGSLTNFAGGNFTSPGYNGVSNYSRNLNCEWSLS
NPNQGNSSIYIHFESFYLESHQDCQFDVLEFRVGNADGPLIWRLCGHSRPTMPLVIPHPQ
VWIHFVTNRQVEHIGFHAEYSFTDCGGIQIGESGAIASPNYPASYDSLTHCSWVAGSPTR
HTITLTFSDFDIEPHSTCAWDSVTVRNGGSPGSPIIGQYCGSSNPRIIQSGSNQLVVIFN
SDHSVQHGGFYATWITQTLGCGGILHSDNGTIRSPHWPQNFPENSRCSWTVITHESKHLE
ISFDNNFLIPSGDEQCQNSFVKVWAGTEEADKALLATGCGNVAPDPIITPKNTFTAVFQA
QGAPAQGFSASFVSRCGSNFTDPSGYIISPNYPKHYDNNMNCTYIIEADSHSVVLLTFVT
FHLEARSAIAGSCANDGLHIIRGYSLSSSPIATLCGEETLAPISTSGPMLLNFYSNAHIT
DFGFKFSYRITSCGGVFNLSIGIIRSPAYSYSNYPNNMYCLYVITVRDDRVIQIKFNDFD
VVPSAFCSQDYLAIYDGSNVSDPLLGKFCGSNLPPNVKSSNNSLLLVFKTDSFQTARGWR
VSFRQTLGPQHGCGGYLTGSNRTFATPDSDSNGRYDSNLNCVWFISAPINKLIKLTFNTF
SLEAATTLRRCSYDYVKLYDGDSENANLAGTFCGSTVPAPFVSSGNFLTVQFVSDIILER
EGFNATYTIVDRPCGGTYNATWVPQSISSPNSSDPDVPFYTCTWVIDAPPHQQNKITVWA
LQLHSRDCSQNYLEFQDSPASNRNPGIRFCGGNISAVPAFYSSVRTAIVVFKAEVFNRNS
RVGFTYQIAGCNREYNKAFGNLKSPGWPDSYNNDLDCTIILTAPQNHTISLFFHSFGIEE
SSECTHDFLEVRNGSDSSYPLLGKYCGALLPNPVFSQNNVLYLRFKSNSGISSHGYEIIW
TSSPSGCGGTLYGDSGSFTSPGYPDTYPNNTHCEWAITSPTGRPVTVSFDFISIDDPGDC
VQNYLILYDGPDADSPSTGPYCGADIAIAPFVGSSHQVFIRFHAVYAVQPSAFRLMWDS
Download sequence
Identical sequences G3TBA9
ENSLAFP00000011243 ENSLAFP00000011243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]