SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011413 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011413
Domain Number 1 Region: 151-304
Classification Level Classification E-value
Superfamily C-type lectin-like 1.82e-45
Family C-type lectin domain 0.00000721
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000011413
Domain Number - Region: 86-172
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00256
Family HBL-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011413   Gene: ENSLAFG00000013636   Transcript: ENSLAFT00000013636
Sequence length 308
Comment pep:novel supercontig:loxAfr3:scaffold_47:11034438:11037789:-1 gene:ENSLAFG00000013636 transcript:ENSLAFT00000013636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVKYEDLQPLESEEKSQTFRNGPCSPQSLLRHLWSGPHLYLLTLGLSLPLLVIICVIGS
QIPKLQWDLVTLRTTSHNFTSSIMAEVQALNSHSGSLQEMITSLRGEMEEHKQELQAARS
LNDKVFTLESELDKQVQELKAVHSSIFQQVQQQAKDLKSLTCQMAALKSNSSGNTHCRTY
WVEHEGSCYWFSHSKKSWSEAEEYCQLSGAHLVVINSLEEQNFVQDYIGSFESWIGLNDP
EGVWKWVDGTDYDTNFKNWDENQPDDWDGHGLGGGEDCAHIQTSGKWNDNVCQRRFHWVC
ETSLGKAS
Download sequence
Identical sequences G3TBP4
ENSLAFP00000011413 ENSLAFP00000011413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]