SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011561 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011561
Domain Number 1 Region: 14-178
Classification Level Classification E-value
Superfamily C-type lectin-like 7.7e-35
Family C-type lectin domain 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011561   Gene: ENSLAFG00000021476   Transcript: ENSLAFT00000013805
Sequence length 180
Comment pep:novel supercontig:loxAfr3:scaffold_193:92488:96830:1 gene:ENSLAFG00000021476 transcript:ENSLAFT00000013805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPVFQTTPWRLISGILGVICLLLMAILGIFLNNCSWLHLNLHQIFSPGLIIELQGDSDCC
SCPEKWIGYRCSCYLIFNAEKTWAESRNFCASQNSSLLQLKSRDELDFLNYRRQFYWLGI
SYNETHGTWLWEDGSAPSQDLFSFFQTLDPKKCIVHSPNKEILDEPCGGKRPYICEQQLI
Download sequence
Identical sequences G3TQG4
ENSLAFP00000017788 ENSLAFP00000011561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]