SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011563 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011563
Domain Number 1 Region: 441-695
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-52
Family YWTD domain 0.00000576
Further Details:      
 
Domain Number 2 Region: 4-261
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-35
Family YWTD domain 0.0000397
Further Details:      
 
Domain Number 3 Region: 359-434,691-740
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000235
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 311-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000642
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 934-979
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000958
Family EGF-type module 0.00076
Further Details:      
 
Domain Number 6 Region: 276-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000547
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 832-885
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000795
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 793-843
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000248
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000011563
Domain Number - Region: 877-904
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00451
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011563   Gene: ENSLAFG00000013803   Transcript: ENSLAFT00000013807
Sequence length 1168
Comment pep:novel supercontig:loxAfr3:scaffold_14:18625817:18723238:1 gene:ENSLAFG00000013803 transcript:ENSLAFT00000013807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPVPFLIFSHGNSIFRIDPEGTNHKQLVADAGVSVFVDFHYSQERIYWVDLERQLLQRVF
LNGTRQERVGNIEKRVSGMAINWINEEIIWSNQQEGVITVTDMKGNNSRVLLSSLNYPAN
VAVDPVERFVFWSSEVGSSLHRASLNGADAKILLETLEKITAMSLDVLNKRLFWIQYNKE
GGYSYIGSCDYDGGSSQLHKHLTRHNLFAISLFGDRIFYSTLKKKAIWIANKHTGKDMVK
INLNQSLAPPGELKVVHPLVQPKAKNDAGESDQKLCKLKKGICRGSVCGQDLRNHVCTCA
EGYTLSRDGKYCEDVNECALWNHGCTLGCENTPGSYYCTCPVGFILLPDGKRCHQLDSCP
SNASECSHDCVLTSDGPVCFCPEGSVLEADGKMCSGCSSSDNGGCSQLCLPLSPVSWECG
CFPGYDLQLDKKSCAASGPQPFLLFANSQDIRHMHFDGTDYEILVSQQMGMVFALDHDPV
ENKIYFANTALKWIERANLDGSKRERLIGDAVDVPEGLAVDWINRKLYWTDRGKALIERS
DLNGTQREIIINKHISQPRGIAVHPMAKRLFWTDMGINPRIESSSLQGSDRRVIASSDLV
QPSGITIDYLTDKLYWCDAKQSVIEVANLDGSKRQRLAQNDVGHIFSVAVFEDHVWFSDW
ATPSVIRVNKRTGQNRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICEGKFGT
ARCSCREGFMKAPDGKMCVTLNGLQVSAAGSEADLSNQVTPLDTLSTSQAFEDNVTEELQ
SQHTLVAEIMVSDQDDCAPVRCGTHAQCVSEGDNATCQCLKGFADDGKLCSDIDECEKNI
TVCPAASSQCINTEGGYVCRCLEGYQEDGIHCLDIDECQLGMHTCGECAICTNTEGNSTC
MCLGSLSEPSQLSKDTAPPSRLREDDLHAARHIYPGCPPSHDGYCLNDGLCMYIEQVDQY
ACKCIVGFIGDRCQHRELRWWKLRHAGHGQQRNIAVVAVCVVGLVLLLLLALWGTRYYRN
QKLLSKNPKNPYEESSRDVSSSKPTDGEAGMSSPQLWFVILKEHQDLKCGSQPVALKDVQ
TADVGQLSSLAPGSVQPTPYRQGPRVHGMNTEQSCWIPSSSNNTSGPQGMEKNLHLPSYV
ARPIAVGAEKLHLLSAKPLWQQRGPNPP
Download sequence
Identical sequences G3TC14
ENSLAFP00000011563 ENSLAFP00000011563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]