SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011610 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011610
Domain Number 1 Region: 183-315
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-31
Family SPRY domain 0.0014
Further Details:      
 
Domain Number 2 Region: 3-36
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000806
Family B-box zinc-binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011610   Gene: ENSLAFG00000021337   Transcript: ENSLAFT00000013864
Sequence length 315
Comment pep:novel supercontig:loxAfr3:scaffold_278:141762:148336:1 gene:ENSLAFG00000021337 transcript:ENSLAFT00000013864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESKNLLCLLCSSSQEHEAHRHCSIEYAVEKYRKAFESWRIIELREYKEDEYRDYILVFTG
EAFKTNEVFMGKDPRKSEKSKRGVQNNQPVDELLHREEKQHLEGLKSERKRILQQLKKSQ
TTMVQKQNHLREMFEELLNLCHKPDVDLLQNLEDTLTRSESVQLHMPQPVNPALSARPIT
GLIDRFNQFQVNISLNYEASSHDIMLSDDVRSLIFRHDLQEVPFPSGRSNYFATWGDQAF
SSGKHYWEMHVDSSWDWAIGVCKDTWLRKNCSVIESGDTFLLLCVKGDNGYHLFTTSPVL
SQYIEKPLGKVGVFV
Download sequence
Identical sequences G3TC54
ENSLAFP00000011610 ENSLAFP00000011610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]