SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011623 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011623
Domain Number 1 Region: 386-453
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-19
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 676-809
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.79e-18
Family Growth factor receptor domain 0.0053
Further Details:      
 
Domain Number 3 Region: 558-687
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.82e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 1339-1402
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.93e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 5 Region: 812-934
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000471
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 1177-1237
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000017
Family TB module/8-cys domain 0.00029
Further Details:      
 
Domain Number 7 Region: 1531-1614
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000691
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 8 Region: 938-1060
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000879
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 1057-1112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000082
Family EGF-type module 0.026
Further Details:      
 
Domain Number 10 Region: 1282-1332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000168
Family EGF-type module 0.008
Further Details:      
 
Domain Number 11 Region: 336-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000191
Family EGF-type module 0.013
Further Details:      
 
Domain Number 12 Region: 267-332
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000536
Family TB module/8-cys domain 0.004
Further Details:      
 
Domain Number 13 Region: 1243-1290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000353
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 158-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000258
Family EGF-type module 0.04
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000011623
Domain Number - Region: 1104-1130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00637
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011623   Gene: ENSLAFG00000013872   Transcript: ENSLAFT00000013879
Sequence length 1619
Comment pep:novel supercontig:loxAfr3:scaffold_99:3733683:3759651:1 gene:ENSLAFG00000013872 transcript:ENSLAFT00000013879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARTPCGGLAPAAPPLLLVLLPLLLQATATSPASPSPSQAVEVAVIAGRPAGIASCRCCPG
WSPGRRRYTRASCRVRSCPPVKGTDPPGCLTPVPPAPSPSPSVRKRQVSLNWQPLTLQEA
RALLRRRRPGGPGGLALLRRRPPPQRAPAGQARVLCPLMCHNGGVCVKPDRCLCPPDFAG
KFCQLHSSGARPPAPAMPGLTRSVYTMPLVNHRDEEHGVASMVSVHVEHPQEASVVVHQV
ERVSGPPYTVLGQSAPREDSYSDASGYGYCFRELRGSDCASPLPGLRTQEVCCRGAGLAW
GVHDCLLCSEHLGHSNQVGAPDIPCPAGFERVNGSCEDVDECATGATAGRCQHGECANTH
GGYTCVCPDGFLLDSSRSSCISQHVISEAKGPCFRVLRDGGCSLPILRNITKQICCCSRV
GKAWGRGCQLCPPFGSEGFREICPAGPGYHYSASDLRYNTRPLGQEPPRVSISQPRPPPV
TSRSPAGELTYPGWVLFPRKKRRSSLADTPPLPGFLPTHRPETQLRPEHRPEPRPGPELP
LPSIPAWPGPEISESGPSVCQRNPQVCGPGRCIPRRSGYTCVCDSGFRLNPQGTHCIDVD
ECRRIPTPCAPGRCENAPGSFRCVCGPGFRAGPRAAECLDVDECRRVPPPCDLGRCENTP
GSFLCVCPAGYQAAPHGASCQADVDECTQNPGLCGRGLCENLPGSFRCVCPAGFRGSACE
EDVDECAQEPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECAQSPPPCAYGCE
NTEGSFQCVCPTGFQPNAAGSECEDVDECENHLACPGQECVNSPGSFQCRACPVGHHLHR
GRCIDVDECSSGAPCGRHGHCTNTEGSFRCSCASGYRPPASRPGPCADVNECLEGDFCFP
HGECLNTDGSFVCTCAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTDGSFECVCPPGH
RASPDLASCLDVDECRERGPALCGAQRCENSPGSYRCVRDCDPGYHSGPEGTCDDVDECQ
EYGPTICGAQRCENTPGSYRCMPACDPGYQPTPGGGCQDVDECRNRSFCGAHATCQNLPG
SFQCLCDQGYEGARDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCPNSPEEFDPMTG
RCVSPQPSAGETDGSASQAPPPRRPSVPRQGPVGSGRRECYFDTAAPDACDILAWNVTWQ
ECCCTVGEGWGGCRIQQCPSTETAEYQSLCPHGRGYLAPSGDPALRRDVDECQLFQDQVC
KSGVCVNTAPGYSCYCSNGYYYHAQRLECIDNDECADEEPACEGGRCVNTVGSYHCTCEP
PLVLDRSSRRCVSNESQSLDDNLGVCWQEVGADLVCSRPRLDRQATYTECCCLYGEAWGM
DCALCPAQDSDDFEALCNVLRPPAYGPPRPGGFGLPYEYGPDLGPPYQGLPYGPELYPQP
VLPYDPYPPPPGPFARREAPYGVPPFDMPDFEDDGGPYGEPEAPAPPSPGTRWRYRSRDT
RGSFPEPEELPEGGGHNGALAGPHEGLEAEECGILDGCAHGRCVRVPEGFTCDCFDGYRL
DITRMSCVDINECDEAEEAAPLCVNARCVNTDGSFRCLCRPGFAPSHQPHHCAPARPRA
Download sequence
Identical sequences G3UA49
ENSLAFP00000024707 ENSLAFP00000011623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]