SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011649 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011649
Domain Number 1 Region: 139-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000123
Family EGF-type module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011649   Gene: ENSLAFG00000013913   Transcript: ENSLAFT00000013912
Sequence length 249
Comment pep:novel supercontig:loxAfr3:scaffold_30:23089562:23096803:-1 gene:ENSLAFG00000013913 transcript:ENSLAFT00000013912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTSLRLLPAPVALLLLVILGSGHYVAGSEHKGTYSGKGEQFSEDHSASGLEVMVTSRSE
MSSVSAMPSGGELSSETDYDYSEEYDDEPQISGYIVDDSVKVEQVVKPPHNKTESEQTSS
KPKRKKKAGKNGKNRKNKKKTPCDAEFQNFCIHGECKYIEHLKAISCKCHQDYFGERCGE
KTMKTQRMVDNDLSKIALAAIVAFVSAVSLTAVVVVITNQLRKRYFREYEGESEETKKLR
QENNAHTIV
Download sequence
Identical sequences G3TC91
XP_003414265.1.64505 ENSLAFP00000011649 ENSLAFP00000011649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]