SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Loxodonta africana 69_3 > ENSLAFP00000011744

Domain assignment for ENSLAFP00000011744 from Loxodonta africana 69_3

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSLAFP00000011744
Domain Number 1 Region: 1176-1237
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.49e-20
Family Complement control module/SCR domain 0.004
Further Details:      
 
Domain Number 2 Region: 144-215
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1118-1177
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000027
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 4 Region: 85-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000526
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 5 Region: 689-744
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000863
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 6 Region: 1049-1111
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000116
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 629-686
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000197
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 8 Region: 562-624
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000249
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 9 Region: 932-993
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000288
Family Complement control module/SCR domain 0.00023
Further Details:      
 
Domain Number 10 Region: 870-944
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000031
Family Complement control module/SCR domain 0.00018
Further Details:      
 
Domain Number 11 Region: 205-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000059
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 12 Region: 809-864
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000737
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 13 Region: 997-1059
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000852
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 14 Region: 508-572
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000183
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 15 Region: 262-324
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000306
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 16 Region: 393-450
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000459
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 17 Region: 455-514
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000102
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 18 Region: 24-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000661
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 19 Region: 318-384
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000288
Family Complement control module/SCR domain 0.005
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000011744
Domain Number - Region: 752-803
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00127
Family Complement control module/SCR domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011744   Gene: ENSLAFG00000014022   Transcript: ENSLAFT00000014023
Sequence length 1238
Comment pep:novel supercontig:loxAfr3:scaffold_16:589568:694833:-1 gene:ENSLAFG00000014022 transcript:ENSLAFT00000014023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
MRFPVKIVWLTLWTVCIAEDCKEPPPKKDSEILTGSWPDKTYPEGTQAIYKCRPGFRTLG
TIILACINGRWLALNPSRICQRKPCGHPGDTPFGSFELIVRGEFEYGAKVVYKCDEGYQM
LGSVNYRDCEPDGWTNDIPICEVVKCLPVTEPENGRLISGALEPDQEYSFGQVVQFQCNS
RFMLDGPKEIHCSADGTWSGKTPKCVEISCKLQEIINGYAVSPDKIFKENERFQYKCNPG
FEYSERGDAICTQNGWSPTPSCKEVTCNPPYIANGYYTPERIKHRSEDKISYTCKNGFYP
ATRGNTAICTSNGWVPTPRCSLKPCDFPEIKNGYLHHQDYYRPYFPVELGKYYYYYCNSG
FVTPEERSGGYITCRREGWSPSVPCLKRCHLYDVENGYSRYSGRYRLEGRSVDVQCNRGY
SLPNGHSTITCTERGWSPPPKCIRVKTCSKSDTLIANGFFSESEYSYPVNKRTQYKCKSG
YMTADGKTSGSITCLESGWSTQPVCIKSCDKPSFVNARPKSNGTKFKLSDQLDYECSAGY
ENTGGSTTGSIVCGDDGWSDTPTCYEKECGVPDLPRNLEASPKKNKYRVGDILRFSCRQR
LKRVGADSTQCYHFGWSPSPPTCKGQVNSCGPPPQLLNGDVKGTKKEEYEHNEVVEYDCS
LRFLMKGSKKIQCVDGKWTTLPICVAEESTCGDIPILEHGYSLPSDPPYHHGDSVEFTCK
ESFTMIGYRSIMCVSGTWNQLPQCIATEQLEICKLPKIPISHSMPSDQTEFNHNANFSYT
CKGKSQNKQTTCINGRWDPELTCTEEIKKPCPPPPHIPNTQNMTMTVNYQEGEKISILCQ
ENYLIQDGDEIVCKDGRWQSIPRCVEKVPCSQPPHIENGTINSTTFSEERKETPTPRLYP
HDTKLTYVCEEGFKLSEEDGITCHLGKWSSPPQCVGLPCEPPPLIDHAVLSHELDSYQHG
EEVTYNCTDGFGIDGPESIKCLRGKWPTLPECKSTGCSKLPTFANAILKDPEKESYRSGE
QVEYECEKDFHLDGSNIVKCIKSRWIGSPTCRDFSCGNPPEVKNANIISEQKTRYPPGER
VRYECNKPYSLYGEVEVMCLRGTWTEPPQCKVDSEGKCGPPPPIENGDTTSFSLPTYAQG
STVEYQCQAFYELQGDKHIKCRNGQWSEPPKCLDACVISEEMMEKHNIKLKWKHDKKIYS
KTNDTVEFTCKWGYTEKTPRATFRTTCQEGKLKYPSCE
Download sequence
Identical sequences G3TCF6
ENSLAFP00000011744 ENSLAFP00000011744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.