SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011907 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011907
Domain Number 1 Region: 454-743
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2e-53
Family Eukaryotic proteases 0.0000187
Further Details:      
 
Domain Number 2 Region: 188-454
Classification Level Classification E-value
Superfamily vWA-like 2.23e-51
Family Integrin A (or I) domain 0.0000141
Further Details:      
 
Domain Number 3 Region: 83-143
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000917
Family Complement control module/SCR domain 0.00035
Further Details:      
 
Domain Number 4 Region: 149-205
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000542
Family Complement control module/SCR domain 0.00029
Further Details:      
 
Domain Number 5 Region: 23-91
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000222
Family Complement control module/SCR domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011907   Gene: ENSLAFG00000014221   Transcript: ENSLAFT00000014221
Sequence length 750
Comment pep:novel supercontig:loxAfr3:scaffold_138:1180950:1197502:-1 gene:ENSLAFG00000014221 transcript:ENSLAFT00000014221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLVALLCLLSLFPGLAAVTPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPLGHYPSPV
SLMCKSNGQWQTPRATRLTKAVCKPVRCPAPLSFENGMYTPRLGSHPVGSNISFECEDGF
TLRGSPVRQCLPNGMWDGETAVCDSGASHCPNPGISVGTVRTGSRFGLGDKVSYRCSSNL
VLTGSAKRECQDNGAWSGTEPICRQPYSYDFPEDVAPALGSSLSHTLGVTNPTQKKNENV
GRKIQIQRSGHLNLYLLLDASQSVAEDDFRIFRDCAAIMVDRLFSFEIKISVAIITFASK
PKVIMSVLNENSQDVTEVINSLENANYKDHENGTGTNIYEALNSVYIMMNNQMHRPGMNT
AAWQEIRHAIILLTDGKSNMGGSPKPAVDNIKEILNINQKRDDYLDIYAIGVGKLDVDWK
ELNELGSKKDGERHAFILQDTKALQQVFEHMLDVSQLTHTICGVGNMSANASNQERTPWH
VTIKPKSQETCRGALISDQWVLTAAHCFRNAEELYLWRVFVGDPNSPWGKDFSIEEVVIS
PGFDVFAKKNQGIPEFYGDDIALLKLAEKVKMSTHARPICLPCTVEANLALRRPRDSTCR
DHESELLNKLSVPAHFVALNGNKLNINLKMGTERASCVQAVLQDKTTFPNLTDVREVVTD
QFLCSGTQDDDNSCKGESGGAVFLERRQRFFQVGLVSWGLYNPCISSDKNSRKKAPRGRM
PPPRDFHISLFRLQPWLRQHLQGVLQFLPL
Download sequence
Identical sequences G3TCU0
ENSLAFP00000011907 ENSLAFP00000011907 XP_003422310.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]