SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011911 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011911
Domain Number 1 Region: 197-467
Classification Level Classification E-value
Superfamily vWA-like 5.34e-58
Family Integrin A (or I) domain 0.00000000885
Further Details:      
 
Domain Number 2 Region: 469-761
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.92e-56
Family Eukaryotic proteases 0.00000000112
Further Details:      
 
Domain Number 3 Region: 159-215
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0000393
Further Details:      
 
Domain Number 4 Region: 92-153
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000236
Family Complement control module/SCR domain 0.0000428
Further Details:      
 
Domain Number 5 Region: 39-79
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000306
Family Complement control module/SCR domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011911   Gene: ENSLAFG00000014225   Transcript: ENSLAFT00000014226
Sequence length 767
Comment pep:novel supercontig:loxAfr3:scaffold_138:1173841:1180105:-1 gene:ENSLAFG00000014225 transcript:ENSLAFT00000014226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPPLCLVPLVLGLLSGDMSTTPLPAAQPRSLCSLEGIEITGGSFRLLQKGQALEYVCPSG
FYPYPVQTRVCRSWGSWSALQARGEKIVKKAECRAIRCPRPQDFENGEFWPRAAYYNLSD
QISFQCYDGYTLRGSANRTCQVTGRWSGQTTICDNGAGYCPNPGIPIGTRKVGSQYRLED
RVTYYCNRGLTLRGSQQRTCLEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGA
DAEDGHSPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKRCLTSLIEKVASYGV
KPKYALVTYATDPNILVRVSDPRSSNADWVTEQLNKISYDDHKLKTGTNTKKALQAVYTM
MSWPGDTPPVGWNRTRHVIILMTDGLHNMGGDPVPVIGEIRSLLDIGRDRKNPREDYLDV
YVFGIGPLVDQGNINALASKKDKEQHVFKVKDMEHLEDVFYQMIDESQSLGLCGMVWEHR
EGTDFHKQPWHVKISITRPGKGFEHCMGAVVSEYFVLTAAHCFTVEDEVHSIKVSVAKDA
GGTVKWQEREIEEVLFHPNYNINGKKAEGIPEFYDYDVVLIKLKKKLTYSQILRPICLPC
TEGTTRALRLPLLATCQQHKEELLPAKDVKALFVSEEKKMLVRKEVYIKNGDKKASCERD
ARNAKGYETVKDISQVVTPRFLCTGGVDPYADPNTCKGDSGGPLIIHKKSRFIQVGVISW
GIVDVCKDHKASQKWQVPAHARDFHINLFQVLPWLKEKLKEENLGFL
Download sequence
Identical sequences G3TCU3
ENSLAFP00000011911 ENSLAFP00000011911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]