SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011958 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011958
Domain Number 1 Region: 130-303,371-550
Classification Level Classification E-value
Superfamily L domain-like 4.25e-54
Family Ngr ectodomain-like 0.001
Further Details:      
 
Domain Number 2 Region: 1012-1201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.11e-43
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 3 Region: 605-779
Classification Level Classification E-value
Superfamily L domain-like 4.76e-30
Family Ngr ectodomain-like 0.0033
Further Details:      
 
Domain Number 4 Region: 1-108
Classification Level Classification E-value
Superfamily L domain-like 1.16e-27
Family Ngr ectodomain-like 0.003
Further Details:      
 
Domain Number 5 Region: 785-825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000237
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 6 Region: 855-981
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000392
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 827-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000376
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000011958
Domain Number - Region: 1197-1237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000144
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 1283-1317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000376
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 1242-1276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000493
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011958   Gene: ENSLAFG00000014273   Transcript: ENSLAFT00000014280
Sequence length 1396
Comment pep:novel supercontig:loxAfr3:scaffold_10:21083489:21152080:1 gene:ENSLAFG00000014273 transcript:ENSLAFT00000014280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSENTIQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRALRGLEVLTLNNNNITTIPV
SSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFTQCSGPASLRGLNVAEVQK
SEFSCSGQGEAGRVPSCTLSSGSCPAMCTCSNGIVDCRGKGLTAIPANLPETMTEIRLEL
NGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFG
GLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQGLAKGTFTSLRAIQTLHLAQ
NPFICDCNLKWLADFLRTNPIETSGARCATPRRLANKRIGQIKSKKFRCSAKEQYFIPGT
EDYQLNSECNSDVVCPHKCRCEASVVDCASLKLTKIPERIPQSTAELRLNNNEISILEAT
GIFKKLTHLKKINLSNNKLSEIEDGAFEGAASVSELHLTANQLESIRSGMFRGLDSLRTL
MLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTISPGAFDTLQSLSTLNLLANPFNCNCR
LAWLGDWLRKRKIVTGNPRCQNPDFLRQIPLQDVAYPDFRCEEGQEEGGCLPRPQCPQEC
TCLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQFTLVPGQLSTFKYLQLVDLSNNKISS
LSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLHGNDISTLREIFADVTPFF
HIQAIGANPLYCDCHLRWLSGWVKTGYKEPGIARCAGPPDMEGKLLLTTPAKKFECQGPP
TLAVQAKCDPCLSSPCQNQGTCHNDPLEVYRCACPSGYKGRNCEVSLDGCISGPCENGGT
CLAQEGDDASFTCSCPTGFEGPTCGVNTDDCVEHACANGGSCVDGVGNYTCQCPLQYVGK
ACEQLVDFCSPDLNPCQHDAQCVGTPDGPRCECMPGYTGHNCSENQDDCGNHRCQNGAQC
VDEVNSYSCLCAEGYSGQLCEIPPRPPAPRSPCEGTECQNGANCVDQGSQPVCQCLPGFG
GPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVSTAEDNGILLYNGDNDHIAVELYQ
GHVRVSYDPGSYPSSAIYSAETINDGQFHTVELVTFDQMVNLSIDGGSPMTMDNFDKHYT
LNSEAPLYVGGMPVDVNSAAFRLWQILNGTSFHGCIRNLYINNELQDFTKTQMKPGVVPG
CEPCRKLYCLHGICQPNATPGPVCHCEAGWGGLHCDQPADGPCHGHKCVHGNCVPLDALS
YSCQCQDGYSGALCSQAGAPADPCGGLRCLHGHCQASATKGSHCVCDPGFSGELCEQESE
CRGDPVRDFHQVQRGYAICQTTRPLSWVECRGACPGQGCCQGLRLKRRKFTFECRDGTSF
AEEVEKPTKCGCALCV
Download sequence
Identical sequences G3TCY1
ENSLAFP00000011958 ENSLAFP00000011958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]