SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012149 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012149
Domain Number 1 Region: 1959-2254
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.07e-98
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000805
Further Details:      
 
Domain Number 2 Region: 459-567
Classification Level Classification E-value
Superfamily Second domain of FERM 1.1e-32
Family Second domain of FERM 0.00023
Further Details:      
 
Domain Number 3 Region: 1146-1249
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-28
Family PDZ domain 0.0000269
Further Details:      
 
Domain Number 4 Region: 569-675
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-27
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 5 Region: 872-976
Classification Level Classification E-value
Superfamily PDZ domain-like 5.78e-26
Family PDZ domain 0.0094
Further Details:      
 
Domain Number 6 Region: 1574-1663
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-22
Family PDZ domain 0.013
Further Details:      
 
Domain Number 7 Region: 1287-1390
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-21
Family PDZ domain 0.025
Further Details:      
 
Domain Number 8 Region: 1666-1759
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-18
Family PDZ domain 0.03
Further Details:      
 
Domain Number 9 Region: 366-458
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-16
Family First domain of FERM 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012149   Gene: ENSLAFG00000014491   Transcript: ENSLAFT00000014500
Sequence length 2267
Comment pep:novel supercontig:loxAfr3:scaffold_30:8723298:8836021:-1 gene:ENSLAFG00000014491 transcript:ENSLAFT00000014500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRSSTSDVLDIHKPPFSHQTFLNKGLSKSMGFLSIRDTQDEEDYFKDISSHNNSGHEDSE
NTCSPYQFKTSTEKKVTSSIGVLPKKKIWASSTDLLCTTDRDSLSGETGRYQRCLSEAVT
VRTSTAPRKKEARYSDGSIALDIFGPQKMDPMYHTRELPTSLAISSALDRIRERQKKLQV
LRKAMNVEEPIRRHKTYHSDIFSISSESPSIISSESDFRQELVRRSEASKKFESSSDLPG
VDETPNQGQSQRPSRQYETPLEGNLINQEIMLKRQEEEMMQLQARMALRQSRLSLYPGDT
IKASMLDITRDPLREMALETAMTQRKLRNFFGPEFVKMTIEPFITLDLPRSILHQTKKGK
NEESRRKVNVMLLSGQRLELTCDTKTICKDVFDMVVAHIGLVEHHLFALATLKDNEYFFV
DPDLKLTKVAPEGWKEEPKKKSKASVNFTMFFRIKFFMDDVSLIQHTLTCHQYYLQLRKD
ILEERMHCDDETSVLLASLALQAEYGDYQPEVYGVSYFRLEHYLPARVMEKLELAYIKQE
LPKLHNTYVGASEKETELEFLKVCQRLTEYGVHFHRVHPEKKSQTGILLGVCSKGVLVFE
VHNGVRTLVLRFPWRETKKISFSKKKITLQNTSDGIKHAFQTDNSKVCQYLLHLCSSQHK
FQLQMRARQSNQDAQDIERASFRSLNLQAESIRGFNMGRAISTGSLASSTLNKLAVRPLS
VQAEILKRLSCSELSLYQPLQNSSKEKSDKASWEEKPRGMSKSYHDLSQASLYPRRKSVI
VNMESPPQTIEESVGKPFNQMARSDTESLAGFTKLNNSKSVASLNRSPERRKHESDSSIE
DPGQAYGIGMTMHSSGNSSSQLPLKENVDALHKRWSIVSSPEREITLLNLKKDAKYGLGF
QIIGGEKMGRLDLGVFISSVTPGGPADLDGCLKPGDRLISVNSVSLEGVSHHAAIEILQH
APEDVTLVISQPKEKISKVPSTPVHLANGMKSYMKKPSFLQDGAIDSSSEDRGWPHGTLK
HISDSSFGLPGGLREGSLSSQDSRTESASLSQSQVNGFFASHGGDRTWKESQHGSPSSSV
ISKASETKRISVDGNRSKAKKPGTSDATDYSDRGDSDMDEATYSSSQDHQTPKKESSSSM
NTSNKMNFKFFSSSPPKPGDIFEVELTKNDNSLGISVTGGVNTSVRHGGIYVKAVIPNGA
AESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPASKGHVPVTP
QCTLSDPDAQSQAQEKMVKRTTHVKDYSFVTEENTFEVKLFKNSSGLGFSFSREDNLVPE
QMNTSTVRVKKLFPGQPAAESGKIDVGDVILKVNGVSLKGLSQQEVVSTLRGTSPEVSLL
LCRPPLGVLPEIDTALLTPVHSPAQVLPNSSKDLSQPSCMEQGTSSDENEMSDKSRQQCK
SPSRRDSYSDSSGSGEDDLVKAPAKMSTLRQTLSNIVSQTQGRHEASRSQEDAICTVFYC
PQEIPNKQELEHSNPPSPLPLDVTPGQSCQNQPESASSNSMDKYHIHDTSEPARQGDLTS
LKNDSENHLEDFELEVELLITLTKSEKGSLGFTVTKGNQSVGCYVHDVIQDPAKSDGRLK
PGDRLIKVNDTDVTNMTHTDAVNLLRAAPKTVRLVLRRILDLPRMPVLPHLLPDIVLTCN
KEELGFSLSGGHNSVHQVIYISDINPRSVAAIEGNLQLLDLIHYVNGVSTQGMTLEEVKG
ALDTSLPSVVLKATRGGHPVVPTTKRAASSSPKPNKASGHHSVEHCSKPTLTPNSSFSKV
NGEGVIEVSYPEGKRCTYQMKGLTNLTLSKESDVQEDDIYDDPQEAEVIQSLLDVVDEEA
QNLLNRRSAAGDARVPGTLKTGGKLSEERAEDTDCDGSPLPEDFSESTSSPKNKVDNHSA
IQKSRERKTDDEITWGSVELPIETTNHEDSNKDHPFLTSEELAALPIIKVLPSGKYTGAR
LKSVVRMLRGFLDQGIPSKELESLQELKPLDQCLIGQTKENRKKNRYKNILPYDATRVPL
GDEGGYINASFIKISVGKEEFVYIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEK
IKCQRYWPNTLGKTTMVSDRLRLALVRMQQLKGFVVRAMTLEDIQTGEVRHISHLNFTAW
PDHDTPSQPDDLLTFISYMRHIHNSGPIITHCSAGIGRSGTLICIDVVLGLISQDLEFDI
SDLVRCMRLQRHGMVQTEDQYIFCYQVILYVLTRLQAEEEQKEQQQP
Download sequence
Identical sequences G3TDD2
ENSLAFP00000012149 ENSLAFP00000012149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]