SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012178 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012178
Domain Number 1 Region: 51-158
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-25
Family C-type lectin domain 0.00000622
Further Details:      
 
Domain Number 2 Region: 254-320
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-16
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 440-506
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 378-444
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000625
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 5 Region: 502-567
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000806
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 6 Region: 199-265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000528
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 7 Region: 635-700
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000584
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 8 Region: 580-645
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 9 Region: 315-382
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000107
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 10 Region: 161-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000161
Family EGF-type module 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012178   Gene: ENSLAFG00000014536   Transcript: ENSLAFT00000014537
Sequence length 768
Comment pep:novel supercontig:loxAfr3:scaffold_33:24723032:24752240:1 gene:ENSLAFG00000014536 transcript:ENSLAFT00000014537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QASCLKATWNWRFQRAGFRAAHLLCFSALICELMDQREVAAWMYNHSIKAYTWNHSRFCQ
KFYTDLVAIQNKNEIAYLNNVIPHYKSYYWIGIRKINNVWTWVGTNKTLTKDAENWDNNE
PNNKQNNQDCVEIYIKSSSAPGKWNDEPCGRRKRALCYTASCQDMSCSKQGECMETIGNY
TCSCYPGFYGPECEYVTECGELDLPQYVLMNCSHPLGNFSFNSQCSFHCPKGSTLTGPSK
LECLASGNWTNEPPRCVAVQCQFLEPPSKGTIDCAHPLAAFAYGSSCKFECRPGYRLRGS
DTLRCIGPGQWTAPMPACEAIACDPMESPVRGTTDCSPSTQEFQYNTSCSFRCAEGFLLR
GAEMARCSDLGQWTVPAPVCQALQCQDLPAPKKAQVNCSHPFGAFRYQSACSFTCEEGLL
LVGASVLQCLATGNWSAVPPECKAITCTPLLSPQNGTMTCVQPLGDSSYKSTCQFSCDEG
FSLSGPERLDCTSSGHWTGSSPTCEAIRCPQLSPPERGSMDCSEAHGEFTVSSTCRFSCG
TGFKLKGSTSVECTTSGKWTAPPPTCEAGTASAPTSEMRCPALITPGQGTMSCTHHLGTF
GLNTTCYFGCNAGFTLTGDSPLRCRTSGQWTAEAPTCRAVKCSELRIIKPVMMNCSNPWG
NFSYGSACTFHCPEGQLLSGSARTACQESGHWSTTMPTCQAGPLTIQEALTYFGGAVASA
TGLLMGGTLLALLRRRFRQKDDGKSPLNPQSHLGTYGVFTNAAFDPSP
Download sequence
Identical sequences G3TDF6
ENSLAFP00000012178 ENSLAFP00000012178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]