SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012210 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012210
Domain Number 1 Region: 543-756
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-45
Family DBL homology domain (DH-domain) 0.0005
Further Details:      
 
Domain Number 2 Region: 234-378
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-43
Family Third domain of FERM 0.00049
Further Details:      
 
Domain Number 3 Region: 884-1034
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-30
Family Pleckstrin-homology domain (PH domain) 0.0021
Further Details:      
 
Domain Number 4 Region: 133-236
Classification Level Classification E-value
Superfamily Second domain of FERM 4.06e-29
Family Second domain of FERM 0.0000869
Further Details:      
 
Domain Number 5 Region: 740-861
Classification Level Classification E-value
Superfamily PH domain-like 8.99e-29
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 
Domain Number 6 Region: 48-133
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-21
Family First domain of FERM 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012210   Gene: ENSLAFG00000014569   Transcript: ENSLAFT00000014576
Sequence length 1042
Comment pep:novel supercontig:loxAfr3:scaffold_109:1522489:1610380:-1 gene:ENSLAFG00000014569 transcript:ENSLAFT00000014576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGTYRVLQTPGTRLGAQNPTGVSTLEPGQGLLATMAQASARGQEKHLSVRVKLLDG
TVEAFNVEPKCSGQLLLTQVWKHLNLTESDYFGLEFQNVQSCWIWLEPMKPIIRQVRRPK
NALLRLAVKFFPPDPGQLQEEYTRYLFALQLKRDLLEGQLTCSDTTAALLASHLLQSEIG
DYDETLDREHLEVNEYLPDQARSLEKVLEFHQKHTGQTPAESDFQVLEIARKLEMYGIRF
HVASDREGTKINLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQ
DTLEFLLGSRDECKNFWKICVEYHTFFRLFDQPKPKAKAVFFSRGSSFRYSGRTQKQLVD
YVKDSGMKKIPYERRHSKTRMSLRALTADVPKQSISFTDSVRTPAFPSSANASFYSVPTS
LVAPTGLPDSKDSSCSLMDPHVLLTKSGAAERSSGTSAGGPDTTRSLEPPAPQACPVPGL
SAETPQPSLSTQKSPLSLNSAFQVTLSPGERGSSPLLSPVLSDVGGARMDNEEETAHKCM
PTDRAYFIAKEILATEWTYLKDLEVLTVWFRSAVVKEDAMPEDLRTLLFSSIDPIYEFHR
GFLHELEQALALWEGHPGTHTHGGHRRIGDVLLRSMRQLQGFTGCFQRHDEVLTELDKAT
RRSKKLEAAYKDFELQKVCYLPLNAFLLKPTQRLAHYQLLLSRLCAQLPPGHPDLPDCRD
ALTATTEVTSGLQHSLVRLENLQKLRELQRDLVGIEGLVAPSREFIREGCLCKLTKKGLQ
QRMFFLFSDMLLYTSRGVSGTSRFRIRGLLPLRGMLVEESENEWSVPHCFTIYSAQKTIV
VAASTHLEMEKWLGDLNTAIEADKKGGTPALPLPASPVCACTPGPSDEASPEQESEDDAQ
GARSSLEGPGQHRSNTTLHVCWYRNTSVSRADLSAAVENQLSGYLLRKFKNSSGWQKLWV
VFTNFCLFFYKTHQDDYPLASLPLLGYSVSVPGEADGIHKDHVFKLQFKSHVYFFRAESK
YTFESRWMEVISKAGSTSGRAP
Download sequence
Identical sequences G3TDH2
ENSLAFP00000012210 ENSLAFP00000012210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]