SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012211 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012211
Domain Number 1 Region: 540-603,871-990
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.18e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0084
Further Details:      
 
Domain Number 2 Region: 11-99,127-204
Classification Level Classification E-value
Superfamily RUN domain-like 3.01e-34
Family RUN domain 0.0014
Further Details:      
 
Domain Number 3 Region: 966-1089
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.45e-26
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012211   Gene: ENSLAFG00000014571   Transcript: ENSLAFT00000014577
Sequence length 1097
Comment pep:novel supercontig:loxAfr3:scaffold_47:5472133:5503208:1 gene:ENSLAFG00000014571 transcript:ENSLAFT00000014577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRTMGSEEDTVKEKLLWDVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRR
RAAGFLRSDKMAALFTKVGKTCPVAGEICHKVQELQQQVEGSRKPLGGSHEALRRQCSAS
GKALTLSPQALKHIWVRTALVEKVLDRVVQYLVENCSKYYEKEALLADPVFGPILASLLV
GPCALEYTKLKTADHYWTDPSADELVQRHRIRGPPNRQDSPAKRPALGIRKRHSSGGASE
DRLAACAREYVESLHQNSRTRLLYGKNNVLVQPKEDMEAVPGYLSLHQSAENLTLKWTPN
QLMNGTLGDSELEKSVYWDYALVVPFSQIVCIHCHQQKSGGTLVLVSQDGIQRPPLHFPQ
GGHLLSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPKLRKRSSIRSVDVEEMGMGRATDY
VFRIVYPGHRHEHNAQSIMPLGLLPPPASPPPASPACSRCSQHLPAHAGGVSGSNHLKRL
PLRLLCESMKRQIVSRAFYGWLAYCRHLSTVRTHLSALVHHNIIPPDRPPGAPGGLTKDV
WSKYQKDKKNYKELELLRQVYYGGVEHEIRKDVWPFLLGHYKFGMSKKEMEQVDAVVAAR
YQRVLAEWKACEVVVRQREREAHPTTLAKFSSGSSIDSHVQRLIHRDSTISNDKTQYSES
GSQSLSLLSLSETNINVFISVDDVEPLGPQGTEDPGPKPEQEQEAGTPGTAVVEQQSVEF
DSPDSGLPSSRNYSVASGIQSSIDEGQSVGFEEEDGGGGEEGSDGPEPVAHAFSEPQDPS
QEKASQARELVEAGEELAAMWAFPGAALSWLRGLPGIPRLGDKGCGVEASPGHSALPAPS
VPCPCCISSFGHQPLPPTLERLASPTSEGLLLFQIELLDTVALNLHRIDKDVQRCDRNYW
YFTPPNLERLRDVMCSYVWEHLDVGYVQGMCDLLAPLLVILDNDQLAYSCFSHLMKRMSQ
NFPNGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELLYEDVF
AVWEVIWAARHISSEHFVLFIALALVEAYREIIRDNNMDFTDIIKFFNERAERHDAQEIL
RIARDLVHKVQMLIENK
Download sequence
Identical sequences G3UGH3
ENSLAFP00000012211 ENSLAFP00000026931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]