SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012428 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012428
Domain Number 1 Region: 447-701
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.04e-69
Family Eukaryotic proteases 0.00000000936
Further Details:      
 
Domain Number 2 Region: 23-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-30
Family Spermadhesin, CUB domain 0.0001
Further Details:      
 
Domain Number 3 Region: 192-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-28
Family Spermadhesin, CUB domain 0.0000362
Further Details:      
 
Domain Number 4 Region: 376-455
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0000269
Further Details:      
 
Domain Number 5 Region: 308-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000005
Family Complement control module/SCR domain 0.0000202
Further Details:      
 
Domain Number 6 Region: 138-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000936
Family EGF-type module 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012428   Gene: ENSLAFG00000014837   Transcript: ENSLAFT00000014840
Sequence length 705
Comment pep:novel supercontig:loxAfr3:scaffold_510:19918:27992:-1 gene:ENSLAFG00000014837 transcript:ENSLAFT00000014840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWLSYLLVVLLFCRVGGSIFITQKLFGEVTSPLYPKPYPNNLETTTVITVPQGYRVKLVF
WQFDLEPSEGCFYDYVKISADKKNLGRFCGQLGSPLGNPPGKKEFLSQGNKMLLTFHTDF
SNEENGAIMFYKGFLAYYQAVDLDECASQLNSVEEDPQPRCQHLCHNYIGGYFCSCRPGY
ELQTDGHSCQVDCSSELYTEPSGYIASMEYPRPYPSDLRCNYSIRVERGLTVHLKFLEPF
EIDDHQQVHCPYDQLQIYANGKSIGEFCGTQRPPDLDSSSNAVDLLFFTDESGDSRGWKL
HYTTEIIKCPQPKALDKFTIIQDLQPQYQFRDYFIATCKQGYQLMEGNKALLSFTAVCQD
DGTWHRAMPKCKIKDCGLPRSLPNGNFNYITTKEVNTYQASIQYSCHEPYYKMQTRAQSS
ESTQGLYTCTAQGIWKNEQTGEKIPRCLPVCGKPVNPVEQKQRIIGGQRAQLGNFPWQAF
TNIHGRGGGALLGDRWILTAAHTLYPKEHDSQSNATVDVFLGHTSVEEITKLGNHPIRRV
SIHPDYRQDESNNFEGDIALLELENSVTLGPNLLPICLPDNETFYDNGLLGYVSGFGITA
ERLASHLRFVRLPVARREACEKWLQEKRRNDVFSQSMFCAGDPSLKQDSCQGDSGGVFAV
KDPNTDRWVATGIVSWGIGCSKGYGFYTKLLNYVDWIKKEMEEES
Download sequence
Identical sequences G3TDY9
ENSLAFP00000012428 ENSLAFP00000012428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]