SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012438 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012438
Domain Number 1 Region: 3-190
Classification Level Classification E-value
Superfamily vWA-like 4.45e-54
Family Integrin A (or I) domain 0.00021
Further Details:      
 
Domain Number 2 Region: 195-317
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000361
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 319-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000733
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 369-407
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000017
Family Chicken cartilage matrix protein 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012438   Gene: ENSLAFG00000014853   Transcript: ENSLAFT00000014851
Sequence length 413
Comment pep:novel supercontig:loxAfr3:scaffold_20:31535262:31566808:-1 gene:ENSLAFG00000014853 transcript:ENSLAFT00000014851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGVCKSRPLDLVFIIDSSRSVRPPEFTKVKTFVSRIIDTLDIGEADTRVAVVNYASTVKI
EFNLQTYSDKQSLKQAVARLTPLSTGTMSGLAIQTAMDEVFTVEAGARGPNFNIPKVAII
VTDGRPQDQVNEVAARARASGIELYAVGVDRADMESLKMIANEPLDDHIFYVETYGVIEK
LSSRFQETFCALDPCMLGTHQCQHVCISDGDGNHHCECSQGYTLNADKKTCSAIDKCALG
THGCEHICVNNRNGSYHCECYEGYTLNEDKKTCSVQDKCASGTHECQHICVSDRAGSHHC
ECYEGYTLNEDKKTCSVRDKCALGTHGCQHICVSDGEASYHCDCYPGHTLNEDKKTCSAI
EEARRLISTEDACGCEATLAFQDKVSSYLQRLNTKLDDILKKLQVNEYGQVHR
Download sequence
Identical sequences G3TDZ9
ENSLAFP00000012438 ENSLAFP00000012438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]