SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012733 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012733
Domain Number 1 Region: 389-547
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.14e-37
Family MAM domain 0.0066
Further Details:      
 
Domain Number 2 Region: 575-680
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 3 Region: 270-379
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-19
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 4 Region: 809-875
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.02e-18
Family Eukaryotic proteases 0.0022
Further Details:      
 
Domain Number 5 Region: 52-164
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000000222
Family SEA domain 0.0051
Further Details:      
 
Domain Number 6 Region: 720-820
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000157
Family Scavenger receptor cysteine-rich (SRCR) domain 0.01
Further Details:      
 
Domain Number 7 Region: 686-725
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 228-266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000602
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012733   Gene: ENSLAFG00000015196   Transcript: ENSLAFT00000015206
Sequence length 875
Comment pep:novel supercontig:loxAfr3:scaffold_13:37605325:37714762:1 gene:ENSLAFG00000015196 transcript:ENSLAFT00000015206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKSPVSLKRSSLSSYEVMFAALFVMLVVVCAGLIAVSWLTIKGSEQDATSESSHEARG
TFKITSGAAYNSNLQDKLSVDFKVLAFDLQQMIDEIFQSSNLKNEYKTSTILQFENDSIT
VTFDLFFAQWVSNENVKEELIQGIEANKSSQLVTFHIDLNSINITVKFTKLKKKKNLSFT
DKLTTSSLPTTDSLLTTPETTISKQYKYPKCNVHLSSFTSTNGNISVDCLPGSRPCADTP
MCIAIDLFCDGELNCPDGSDEDDKICATACDGRFLLTGSSGSFQAAHYPNSSESSIVCQW
IIRVNQGLSIELSFDPFNMYYTDVLNIYEGIGPSKILRAFIWETNPGIIRIFSNQVTVTF
LIESDESVYAGFNAKYNAFNSLDLNNYEKINCNFEDGFCFWIQDLNDDNEWERVQGSTFP
PFSGPDFDHTFGNTSGFYISTPTGPGGRQERVRLLSLPLVLTGEPACLSFWYYMYGEKVY
KLTINISTDQNMEKTIFQKEGNYGENWNYGQVTLNETVEFKVAFDGFKNGLLSDIALDDI
SLTNGICNMSLYPEPTLVPTAPPELPTDCGGPFELWEPNTTFSSMNFPNDYPNQAFCIWN
LNAQTGKNIQLHFQEFDLEDIADVVEIRDGREDDSLLLGAAVYTGSGPVKDVFSTTNRMT
VLFITDDLVTSRGFKANFTTGYHLGVPEPCKEDNFQCETGECVPLVNLCDSYPHCKDGSD
EAHCVRLFNGTMNNKGLVQFRIQSIWYAACAENWTTQISNDVCQLLGFGSENSSMPVLST
GDGPFVKLNTAPNGSLIPTPSQKCLQDSLIQLQCNQKTCGEKPVAREVSPKIVGGSNAEE
GAWPWVVALYYNGRLLCGASLVSSDWLVSAAHCVY
Download sequence
Identical sequences G3TEP2
ENSLAFP00000012733 ENSLAFP00000012733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]