SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012737 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012737
Domain Number 1 Region: 140-258
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.52e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 244-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000519
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 3 Region: 15-70,112-168
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000204
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000012737
Domain Number - Region: 286-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00288
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012737   Gene: ENSLAFG00000015210   Transcript: ENSLAFT00000015211
Sequence length 448
Comment pep:novel supercontig:loxAfr3:scaffold_9:68687971:68779704:-1 gene:ENSLAFG00000015210 transcript:ENSLAFT00000015211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLTLHRILTVTILALCIPGPGNAQQQCSNGFDLDRTSGQCYDVDECRTIPEACRGDMMCV
NQNGGYLCIPRTNPVYRGPYSNSFSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMD
ESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTEGYWLLEGQCLDIDECRYGYCQQL
CANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCMQTCVNTYGSFICRCDPGYELED
DGVHCSDMDECSFSEFLCQHECVNQPGTYFCSCPPGYILLDDNRSCQDINECEHRNHTCS
LLQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAENPGCRDQPFTILYRDMDVVSGRS
VPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPRDIQLDL
EMITVNTVINFRGSSVIRLRVYVSQYPF
Download sequence
Identical sequences G3TEP6
ENSLAFP00000012737 ENSLAFP00000012737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]