SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012866 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012866
Domain Number 1 Region: 991-1150
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-42
Family C-type lectin domain 0.00000623
Further Details:      
 
Domain Number 2 Region: 146-263
Classification Level Classification E-value
Superfamily C-type lectin-like 4.71e-37
Family Link domain 0.0016
Further Details:      
 
Domain Number 3 Region: 266-364
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-29
Family Link domain 0.0043
Further Details:      
 
Domain Number 4 Region: 1151-1211
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000107
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 5 Region: 40-153
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000224
Family V set domains (antibody variable domain-like) 0.024
Further Details:      
 
Domain Number 6 Region: 948-983
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000026
Family EGF-type module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012866   Gene: ENSLAFG00000015356   Transcript: ENSLAFT00000015357
Sequence length 1244
Comment pep:novel supercontig:loxAfr3:scaffold_26:22935645:22956826:-1 gene:ENSLAFG00000015356 transcript:ENSLAFT00000015357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVMSPWATGLLMFQMLLLVVGEQGTQDAEKGLRMQKVGSGTVQAALAELVALPCLFTLR
PRPGMARDAPRIKWTKVRTASGQRQDVPILVAKDNVVRVAKGWQGRVSLPTYPWHRANAT
LLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRAAQDRYALTFAEAQEACHL
SSATIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPGVRSYGRRD
PQELYDVYCFARELGGEVFYVGPARRLTLAGARAQCRRQSATLASVGQLHLAWHEGLDQC
DPGWLADGSVRYPIQTPRRRCGGPTPGVRTVYRFANRTGFPAPASRFDAYCFRAHHPTSQ
HGDPETPSSGDEGEILSAEGPPTREVEPSLGEEEPVSTDFQEPPVSSGEEEPLILTEKQE
SQETPSPGPRSTTLAWASMSSLEAKEAWLSTVAPSPSSEEGTVVGTHTEAPLAGPTPRRK
GRFKGLNGRHFQQQELEQGLDGELEASILPPTLEVTGNHVEPPHPMGATEASADPSPWDI
LNNEVEGPGAYPPGGRSSPEPWLWLPTTVPPISLELQEADEPTMRPAASTQPWPPSESPT
LALSPRTDPQDASLMVTSLDFPVMAMLRASKPWLLAPLTPVPTEGLGAEYPSLGPPRQSG
EATSLILSGYRASSSPAPSQEVMDPGARAIPNSISTDAREVGGTSSARLSKPEHPSPSSF
ASVGKNMAADFTPAETTAEPTGAGDILGSESGVFNLPATMDEVDSGGLHLQPQAAPSGGP
GVSLVPGVPLFDRAGNLSFLEPQAAVDGGAMEGPTDPTTTGDLPPVTVDTRVVTSLTSLD
LEDKLEVLATSALASSSFEPHPEAEGQSGILGASAPPWKGRPSWTPTAAIVDEAASISSG
EPTTPWESPGTLLPSSLGPKELDLEVLAGGPGVEGLWEEAASGGEDPSDPCENNPCLHGG
TCKANGTMYGCSCDQGFAGENCENIDDCICSPCENGGTCIDEVNGFVCLCLPSYGGSLCE
KDTEGCDRNWHKFQGHCYRYFAHRRAWEDAERDCRHRAGHLTSVHSPEEHSFINSFGHEN
TWIGLNDRIVERDFQWTDNSGLQYENWRENQPDNFFAGGEDCVVMVAHESGRWNDVPCNY
NLPYICKKGTVLCGPPPAVENASLVGARKAKYNVHATVRYQCDEGFAQHHVATIRCRGNG
KWDRPQIVCTKPRRYHRMRKPRKERRKHKKHPVEDWEKEEGNFC
Download sequence
Identical sequences G3TEZ8
ENSLAFP00000012866 ENSLAFP00000012866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]