SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012997 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012997
Domain Number 1 Region: 1124-1872
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.9e-266
Family Motor proteins 0.000000000244
Further Details:      
 
Domain Number 2 Region: 3216-3331
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000236
Family Second domain of FERM 0.01
Further Details:      
 
Domain Number 3 Region: 2787-2871
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000626
Family SH3-domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000012997
Domain Number - Region: 3332-3426
Classification Level Classification E-value
Superfamily PH domain-like 0.000292
Family Third domain of FERM 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012997   Gene: ENSLAFG00000015498   Transcript: ENSLAFT00000015511
Sequence length 3447
Comment pep:novel supercontig:loxAfr3:scaffold_96:2827158:2900182:1 gene:ENSLAFG00000015498 transcript:ENSLAFT00000015511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEDDEKKAKKGKKGKKAPEPEKPKRSLKGTSRLFMGFRDRTPKISKKGQFRSASAFFWGL
HTGPKKTKRKKKARTVLKSTSKLMTQMRMGKKKRAMKGKKPSFMVIRFPGRRGYGRLRPR
ARSLSKASTAINWLTKKFLIKKAEELGSEQATLDAWLNRSGSHGSYKLHFPSGAEILRHG
GRLRRFPRSRSIYESGEPVGFLPFEDEAPFRPSGSRRSLYGLEGFQDLGEYYDYYREGDD
YYDQQSLYQYEEQEPYLAGYGPYNPAWPPYGGDPYYGYPPEDPYDHYPADYYGDSYPPYP
YGYSYGYDDYEPPYAPPSGYASPYSYYDGYEGEAYPYSHHLDPYTPYYMPYPPYNLPYEI
PYFDHYGVPYSIPYAESIYGGGAEAIYPPETPYLYPEESAFMYPWVPPPILSPHNPYAHP
MDDIAELEEPEEAGGERQGTSFRLPSAAFFEQQGMDKPARSKLSLIRKFRLFPRPQVKLF
GKEKLEVPLPPSLDIPLSMTPVSYRHPFWGFLTPRQRNLQRALSAFGARHEFGRLPARPA
TSLARFLKKTLSEKKPIPRLWGSQKAGARAPAVREAAYKRFGYKLAGMDPEHPTTPISLR
RVQPRAGNNSRPLGPSRPDSPGGSVRRHPPPWAAPAHVPLAPQASWWSFVEPPPVRPEGA
ADKLAFPGPRPSLTVSRRRGQASAFTGRSPQISRRLCWHSLPSPQPSLRSLPGPGYGSPR
GPLSPQPSLRLGPFQPPFSPLPCRPRSLREPLTPRSSSRRLGSPRPPPRSVGQRLPASPP
LLGPSLGRRSLNLPSRLPHTWKRLSEPPTRAVKPRVCPPFFHRLPGSGSRPVSRAAPEPR
ESEEDSETLWTVPPLAPSWDVDMLPTQRPPSPWPGGVSSRRGLSRQPLVPENPFLEHLGP
VPFPTPKPKDSTSDAVNVFLGRHCEPGSEQLLKSAGLSPVKPEESGLVDPQTPSEPEPPN
MTPPKDLIPEKAPRPSLSHPLATCDRMRAIWPPWRHWMTMPRVPGPLAPTGAPEPLPEGG
KQCQAGPGQCAVVMPQVQKLSSFQQVGRATLQPPVQPAQDPQPSPEPRAWSLRRARLLQP
AEGHRPWPRVHTCPPSRRLGPEAAYLPHRGAWKEVGPQSWQNKMHSIRSLPSLRSREQRG
EDGVEDMTQLEDLQEATVLSNIKTRFERNLIYTYIGSILVAVNPYRMLGIYGPEQVQKYN
GRALGENPPHLFAIANLAFAKMLDAKQNQCIIISGESGSGKTEATKLILRYLAAMNQKQG
ITQQVQILEATPLLESFGNAKTVRNDNSSRFGKFMEIFLEGGMISGAMTSQYLLEKSRIV
FQAKNERNYHIFYELLAGLPAQLRQTFSLQEAETYYYLNQGGNCEIQGKSDADDFRRLLA
AMEVLCFSGEDQDSIFRILASILHLGNVYFEKYETDAQEVASVVSAREIQAVAELLQISP
EGLQKAITFKVTETMREKIFTPLTVESAVDARDAIAKVLYALLFGWLIARVNALVSPSQD
TKSIAILDIYGFEDLSFNSFEQLCINYANENLQYLFNKIVFQEEQEEYVREQINWQEITF
VDNQPCINLISLKPYGILRILDDQCCFPQATDHTFLQKCNYHHGTNPLYSKPKMPLPEFT
IKHYAGKVTYQVHKFLDKNHDQVRQDVLDLFIKSRTRVVAYLFASHAPQAAPQRLGKSSS
VTRLYKAHTVAAKFQQSLLDLVEKMEKCSPLFVRCLKPNHRKEPGLFEPEVVMTQLRYSG
VLETVRIRKEGFPVRLSFQIFIDRYRCLVALRHNVPATGDMCVSVLSRLCSVTPNMYRVG
VSKLFLKEHLYQLLESMRERVLHLAAVTLQRCLRGFLIQRRFRSLRHKIILLQSRARGYL
ARQRYQRMRRGLLKFRSLVHLYISRRRYLKLKAEQRHQVEEARLREQEELSKRELVAVGH
LEVPAELAGLLQAAAGLRLAQAPQVAPMRTPRLQAEPRVTLPLDINNYPMAKFVRCHFKE
PAFGMLTVPPRTPLTCLPAEHHREAVCIFKLVLRFMGDTHLHGVQEQVFGNYIVQKGLAV
PELRDEILAQLANQVWRNPNAHNAERGWLLLATCLSSFTPSSRLNKYLLKFVSDYGQNGF
QAVCQQRLVQAMGRAQQQGSRVARTFPPTQLEWKVTQEKASMALDVGCFNGDQFSCPVHS
WSTGEELAGDILRHRGLADGWRGWTVAMKNGVQWAELAGHDYVLDLVSDLELLRDFPRQK
SYFIVGAEGPVAGKGGPSVVFGSSWDSDEDMPVRPPPQGHVPQVPDSYRHCSHNEGGSLG
AVGVETSSHSQADWDNLGEPAVPHRGLDCYLDSLFDPVLSYGDADLEKPTAIAYRMKGGG
QPGGGGSSSSEDTPGRPPEPKPIPGLDASTLALQQAFIRKQAVLLAREMTLQAMALQQQP
LGPAPRPLPPEKPLVPEAWPKSVGTGPPAKSVLLRSAPRPVTPAPTTKAPRPPTKPAAVP
VLAQDRASPETTTASLELVRHSKLNSEHFPQPTQQIKNIVRQYQAPRGGRPEALRKDGGK
VFMKWPDPHEEALMLLKEQMTHPAAAPGTQVPREAVALVKPVTSVQRPSMEPTPELPSRS
LEPLEEPVQTRLHRLINPTFYGYRDAPWRIFLRKEVFYPKDNYNHPVQLDLLFRQILHDT
LSEACLRISQDERLRMKALLAQNQLDTQRPLVTESMKRAVVNTARDSWEVYFSRLFPATG
SVGTGVQVLAVSHVGIKLLRMVKGSREASGQLRVLRTYSFADILFVTIPSQNMLEFNLAS
EKVILFSARAHQVKTLVDDFILELKKDSDYVVAVRNFLPEDPALLAFHKGDIIHLQPLEP
PRVGYSAGCVVRKKVVYLEELRHGGPDFGWRFGTIHGRVGRFPSELVQPVAAPDFLQLPA
EPGRGRLVEGSQQGVGSAGTRHVGRPKEGSTSRVGTPDCRKDALAPPQLPMLEFAQKYFR
DPQKRPQDGLKLKSKECWVSRNLEDMIPLQESLIEFSDSSLNKMATDMFLAVMRFMGDVP
LKGQSELDVLCTLLKLCGDHEVMRDECYCQVVKQITDNTSTKQDSCQRGWRLLSIVAAYH
SCSEVFQPYLLRFLQDMSQASGLPFQGIAKACEQNLQKTLRFGGRLELPSSMELRAMLAG
RSSKRQLFLLPGGLERHLKIKTCTVALDVLVGICTRAQPRWVCTHTHTYAPRSPASLLSA
GQHVCPLSRRAYILDVASEMEQVDGGYMLWFRRVLWDQPLKFENELYVTMHYNQVLPDYL
KGLFSMLPSRPSEQQLQQVSKLALLQHCTKDHFYLPNVWEVREYIPAQLYHTTAGSTWLS
LISQHWQQTQALSPHQARAQFLGLLSALPMFGSSFFFVQSCSNMAVPAPCILAVNHNGLN
FLSTETHELMVKFPLKEIQSTRTQRPTANSSYPYVEITLGDMAAQHTLQLQLEQGLELCR
VVAAHVENLLSAREKRLTLPPSEITLL
Download sequence
Identical sequences G3TFA7
ENSLAFP00000012997 ENSLAFP00000012997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]