SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013013 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013013
Domain Number 1 Region: 5-129
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-43
Family Galectin (animal S-lectin) 0.00000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013013   Gene: ENSLAFG00000015531   Transcript: ENSLAFT00000015528
Sequence length 130
Comment pep:novel supercontig:loxAfr3:scaffold_73:8014333:8016305:1 gene:ENSLAFG00000015531 transcript:ENSLAFT00000015528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQEEFEIKNMDMKLGATLKIKGKIANDAVGFVINLGQGAEKLNLHFNPRFNESTIVCNSR
DGSWGQEQRSNHLCFSPGSEVKFTVTFENKQFKVTLPDGHVLTFPNRLGHSHLSYLGVKG
GFKISSFKLD
Download sequence
Identical sequences G3TFC0
ENSLAFP00000013013 ENSLAFP00000013013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]