SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013115 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013115
Domain Number 1 Region: 1841-2015
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 5.75e-61
Family Sec63 N-terminal domain 0.0000000182
Further Details:      
 
Domain Number 2 Region: 1214-1505
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2e-55
Family Tandem AAA-ATPase domain 0.00043
Further Details:      
 
Domain Number 3 Region: 1010-1182
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.83e-52
Family Sec63 N-terminal domain 0.00066
Further Details:      
 
Domain Number 4 Region: 676-888
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.83e-48
Family Tandem AAA-ATPase domain 0.00098
Further Details:      
 
Domain Number 5 Region: 410-666
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.09e-44
Family Tandem AAA-ATPase domain 0.00021
Further Details:      
 
Domain Number 6 Region: 1514-1723
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.04e-43
Family Tandem AAA-ATPase domain 0.0034
Further Details:      
 
Domain Number 7 Region: 2016-2128
Classification Level Classification E-value
Superfamily E set domains 6.58e-32
Family Sec63 C-terminal domain-like 0.000000833
Further Details:      
 
Domain Number 8 Region: 1723-1824
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000462
Family RecQ helicase DNA-binding domain-like 0.074
Further Details:      
 
Domain Number 9 Region: 888-993
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000199
Family RecQ helicase DNA-binding domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013115   Gene: ENSLAFG00000015626   Transcript: ENSLAFT00000015641
Sequence length 2136
Comment pep:novel supercontig:loxAfr3:scaffold_129:1485587:1517618:-1 gene:ENSLAFG00000015626 transcript:ENSLAFT00000015641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTK
PQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFI
QAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKIT
DYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDR
ECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEPEKERIMGKMEADPELSRFL
YQLHETEKEDLIREERCRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGS
HFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKT
LNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIY
VAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKG
GERTYTQLVRLVILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYED
VATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQ
VLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPY
GFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGR
WTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDM
LNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTA
ALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSL
SSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMAD
MVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVV
KKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKV
ELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFE
PLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESL
YQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQNSEGRCVYIT
PMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIVLSTPEKWDILSRRWK
QRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDV
AHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVI
VFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYL
HEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYP
IYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEI
VTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSK
CISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPI
RHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAI
RLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVE
SVFDIMEMEDEERNALLQLSDSQMADVARFCNRYPNIELSYEVVEKDSIRSGGPVVVLVQ
LEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAPATG
AHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD
Download sequence
Identical sequences G3TFK2
ENSLAFP00000013115 XP_003422047.1.64505 ENSLAFP00000013115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]