SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013218 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013218
Domain Number 1 Region: 90-256
Classification Level Classification E-value
Superfamily RUN domain-like 5.49e-51
Family RUN domain 0.000000233
Further Details:      
 
Domain Number 2 Region: 619-686
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.63e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000013218
Domain Number - Region: 448-548
Classification Level Classification E-value
Superfamily Tropomyosin 0.00196
Family Tropomyosin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013218   Gene: ENSLAFG00000015754   Transcript: ENSLAFT00000015760
Sequence length 689
Comment pep:novel supercontig:loxAfr3:scaffold_1:106014492:106089804:1 gene:ENSLAFG00000015754 transcript:ENSLAFT00000015760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PERGPEPGPESGEEFEIVDRNQLPSPGELKSAAQPRAAADGWSAPILTLARKATVNLSAS
CGSALRAAAGRGVGDGIGDGAARAAAKCQMMEERANLMHMMKLSIKVLLQSALSLGRSLD
ADHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLELVEKFCPEASDIATSVKNLPE
LKTAVGRGRAWLYLALMQKKLADYLKVLIDNKHLLSEFYEPEALMMEEEGTVIVGLLVGL
NVLDANLCLKGEDLDSQVGVIDFSLYLKDVQDLDGGKEHERITDVLDQKNYVEELNRHLS
CTVGDLQAKIDGLEKTNSKLQEELSAAAGRICSLQEEQHQLREQNELIRERSEKSVEITK
QDTKVELETYKQTRQGLDEMYSDVWKQLKEEKRVRSELEKELELQIAMKTEMEIAMKLLE
KDTHEKQDTLVALRQQLEEVKAINLQMFHKVQNAESNLQQKNEAITSFEGKTTQVMSSMK
QMEERLQHSEQARQGAEERSHKLQQELGGRVSALQQQLAQLHMQCSSLEKELKSEKEQRQ
ALQRELQHEKDTSSLLRTELQQVEGLKKELRELQDEKAELQKVCNEQEQALQEMGLHLSQ
SKLKMEDIKEVNKALKGHTWLKDDEATHCKQCEKEFSISRRKHHCRNCGHIFCNTCSSNE
LALPSYPKPVRVCDSCHTLLLQRCSSTAS
Download sequence
Identical sequences G3TFS9
ENSLAFP00000013218 ENSLAFP00000013218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]