SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013222 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013222
Domain Number 1 Region: 277-445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-42
Family SPRY domain 0.00022
Further Details:      
 
Domain Number 2 Region: 6-70
Classification Level Classification E-value
Superfamily RING/U-box 3.98e-17
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 77-139
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000137
Family B-box zinc-binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000013222
Domain Number - Region: 156-232
Classification Level Classification E-value
Superfamily CorA soluble domain-like 0.0432
Family CorA soluble domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013222   Gene: ENSLAFG00000023298   Transcript: ENSLAFT00000015766
Sequence length 446
Comment pep:novel supercontig:loxAfr3:scaffold_62:13210283:13217841:1 gene:ENSLAFG00000023298 transcript:ENSLAFT00000015766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVPXTCCICLNYLTDPVTTGCGHSFCRPCLYISWEEAKTTRCPLCGETSKKTDIKSNIL
VKNLVSLARQASLCQFLSSEDQMCGTHKETKKMFCEESKNLLCLLCSSSQEHEAHRHCSI
EYAVEKYREKLLKQMRSLWDQLGEISTCCKTGGKEKEKDLVIFHILENIRDMIRDQYRKL
HPVLHREEKQHLEGLKSERKRILQQLKKSQTTMVQKQNHLREMFEELLNLCHKPDVDLLQ
DKQSTIKKCSGIQVLTKVQLVMVIGLENFVHKHKIIRKLLPRRSVNISLNYETSSHDIML
SDDVRSLIFRHDLREVPFPSGRSNYFATWGAQAFSSGKHYWEMHVDSSWDWAIGVCKDTW
LRKNCSVIESGDTFLLLCVKGDNGYHLFTTSPVLSQYIEKPLGKVGVFVDFNSGSVSFVH
VAKNSLIWEYSAYSFNYSLRPFFCTG
Download sequence
Identical sequences G3TFT3
ENSLAFP00000013222 ENSLAFP00000013222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]