SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013233 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013233
Domain Number 1 Region: 622-913
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000727
Further Details:      
 
Domain Number 2 Region: 215-359
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-39
Family Third domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 7.98e-37
Family Second domain of FERM 0.0000901
Further Details:      
 
Domain Number 4 Region: 30-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.89e-22
Family First domain of FERM 0.00096
Further Details:      
 
Domain Number 5 Region: 510-604
Classification Level Classification E-value
Superfamily PDZ domain-like 8.25e-21
Family PDZ domain 0.00000974
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013233   Gene: ENSLAFG00000015771   Transcript: ENSLAFT00000015779
Sequence length 926
Comment pep:novel supercontig:loxAfr3:scaffold_46:2743574:2921230:1 gene:ENSLAFG00000015771 transcript:ENSLAFT00000015779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRFRLPAGRTYNVRASELARDRLHTEVVCNILLLDNTVQAFKVHKHDQGQVLLDVVFK
HLDLTEQDYFGLQLADDSSDNPRWLDPNKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPCNTAALLASFAVQSEFGDYNQSENLPGYLSDYSFIPNQ
PQDFEKEIAKFHQQHTGLSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEIMIGVMSGG
ILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKT
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFASSSN
QQGSRKSESFKIKGRNSLSDDRLETQSLPSRSPPGTPNHRNSAFTQEGARLRPSSVGHLV
DHAVHTSPSDVSVNHRSPSSTQANSIVLESSPSQETPGDEQPPALPPKQSKKNSWSQIHY
SHSQQDLENHSDETFDVPSSPEKSTPNGGIPHDNLVLIRMKPDENGRFGFNVKGGYDQKM
PVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVMFIKASCERHSGELVLL
VRPNAVYDVVEEKLENEPDFQYIPEKAPVDSVHQDDHSLRESMIQLADGLITGTVLTQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSII
NQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQ
VTCHSEEGNTAYVFRKMTLFNQEKNESRQLTQIQYIAWPDHGVPDDSSDFLNFVCHVRNK
RAGKEEPIVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YRFVCEAILKVYEEGFVKPLTSSSNK
Download sequence
Identical sequences G3UI66
ENSLAFP00000013233 ENSLAFP00000027524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]