SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013328 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013328
Domain Number 1 Region: 125-266
Classification Level Classification E-value
Superfamily C-type lectin-like 8.4e-42
Family C-type lectin domain 0.00000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013328   Gene: ENSLAFG00000015889   Transcript: ENSLAFT00000015891
Sequence length 269
Comment pep:novel supercontig:loxAfr3:scaffold_47:11066117:11074046:-1 gene:ENSLAFG00000015889 transcript:ENSLAFT00000015891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSPDTPSPAGTPPPQPFLQRFCSRPRLSLLALGFNVLLLVVICMIGSQSTQLQMELRALK
ETFNNFSVTTLTEVRALNFHGVNVSDRVTFLEANLEKQNEDLKSDHANLLLHLKQFPVDL
RILECHITFFQSNGTKCCPVNWMEHDGSCYWFSRSGKTWSEADKYCQLEDAHLVVINSKE
EQQFILQHASPFHTWLGLTSTGGSWKWVDGTDYENGYKNWAYTQPDNWQGREVGGSEDCV
EIQSNGQWNDDLCLQMHRWVCETRKNHTT
Download sequence
Identical sequences G3TFX3
ENSLAFP00000013328 ENSLAFP00000013328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]