SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013340 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013340
Domain Number 1 Region: 929-1104
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.91e-36
Family Pentraxin (pentaxin) 0.00081
Further Details:      
 
Domain Number 2 Region: 1635-1704
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-19
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 3 Region: 1336-1405
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-18
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 4 Region: 2264-2333
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.06e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 1452-1520
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.14e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 6 Region: 2322-2391
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.78e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 7 Region: 1870-1940
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 8 Region: 2206-2275
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 9 Region: 2730-2799
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.64e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 10 Region: 1278-1347
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.17e-17
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 11 Region: 2380-2449
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.28e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 12 Region: 2045-2112
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 13 Region: 1754-1822
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.92e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 14 Region: 2160-2217
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.89e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 15 Region: 1394-1459
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.73e-16
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 16 Region: 724-855
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.94e-16
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 17 Region: 2553-2618
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.42e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 18 Region: 1929-1998
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000107
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 19 Region: 1173-1236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000133
Family Complement control module/SCR domain 0.00073
Further Details:      
 
Domain Number 20 Region: 2907-2966
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 21 Region: 1988-2050
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000473
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 22 Region: 2790-2854
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 23 Region: 1118-1190
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000834
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 24 Region: 2439-2501
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000848
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 25 Region: 2498-2564
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 26 Region: 1689-1747
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000195
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 27 Region: 1813-1881
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 28 Region: 2848-2916
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000361
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 29 Region: 2612-2675
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000361
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 30 Region: 1509-1577
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000431
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 31 Region: 850-891
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000746
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 32 Region: 1573-1646
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000208
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 33 Region: 888-928
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000224
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 34 Region: 492-636
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000278
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 35 Region: 2672-2735
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000138
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 36 Region: 699-736
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000071
Family EGF-type module 0.014
Further Details:      
 
Domain Number 37 Region: 3-65
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000723
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 38 Region: 1232-1275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000123
Family EGF-type module 0.035
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000013340
Domain Number - Region: 2958-2994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000154
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 2997-3026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000239
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 233-293
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000602
Family Complement control module/SCR domain 0.0069
Further Details:      
 
Domain Number - Region: 3026-3057
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000967
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013340   Gene: ENSLAFG00000015893   Transcript: ENSLAFT00000015906
Sequence length 3062
Comment pep:novel supercontig:loxAfr3:scaffold_6:49260470:49355670:1 gene:ENSLAFG00000015893 transcript:ENSLAFT00000015906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEHHCSTFQKPKGVIVSPTNCGKQPAKPGTVCQLSCRQGFMLSGARELRCTTSGKWSAKV
QTAICKDVEAPQINCPRDIEAKTQEQQDSANITWQIPTARDNSGEKVSIHVHPAFSPPYL
FPIGDVAVTYTATDLSSNQASCTFHIRVIDVEPPAIDWCRSPPPIQVSEKEYAATWDEPQ
FSDNSGAVLVITRSHSPGDLFPHGETVVQYIATDPSGNNRTCDIHIVIKGSPCEVPFAPV
NGDFICTQDSAGVNCTLSCLEGYDFTEGSTEKYYCAYEDGIWKPPYSTEWPDCAIKRFAN
HGFKSFEMLYKATRCDDTDLLKKFSEAFETTLGKMVPSFCNDAEDIDCRLEDLTKKYCLE
YNYDYENGFAIGPGGWGAANRLDYSYDDFVDVMQETPTGTSKARPSRIKRGAPISDYKIK
LIFNITASVPLPDERNDTLELENQQRLIKTLETITNRLKRTLDEEPMYSFQLASEILVAD
INSLETEKAFLFCRPGSVLRGRMCVNCPLGTYYSLEHSVCESCGIGSYQDEEGQLECKLC
PAGTYTKYLHSRTISECKAQCQQGTYSSNGLETCESCPLGTYQPAFGSRSCLLCPENTST
VKRGAVDISACGVSCPVGEFSRSGLMPCYPCPRDYYQPDPGKSFCLSCPFYGTTTITGAR
SITDCSTFSSTFSAAEESIVPRVSPGHIKKKHEISSQVFHECFLNPCHNGGTCQQLGLGY
VCLCPPGYTGLKCEIEIDECSSLPCLNNGVCKDHVGEFICECPSGYTGQLCEENINECSS
SPCLNKGTCVDGLAGYHCVCIKGFIGLHCEIEVNECQPSPCLNNAVCEDQVGGFLCKCPP
GFLGTRCEKNVDECLSQPCKNGATCKDGINSFRCHCAPGFTGPHCESNINECQSNPCRNQ
ATCVDELNSYSCKCRPGFSGSRCETEQSTGFNLDFEVSGIYGYVMLDGVLPSLSAVTCAF
WMKSSDITNYGTPISYALENGSDNTFLLTDYNGWVLYVNGKERITDCPSVNDGRWHHIAI
TWTSVGGAWKVYIDGKLSDGGSGLSAGSAIPGGGALVLGQEQDKKGEGFNPAESFVGTIS
QLNLWDYVLSPQQVKSLATSCPEEGIVGKVKIDSKSIFCSDCPSLEGAVPHLRTASADLK
PGSKVSLFCDPGFQMVGNPVQSCLNQGQWTQPLPHCERICCGVPPPLENGFYSAEDFYAG
STVTYQCSNGYYLLGDSRMFCTDNGSWNGISPSCLDVDECAVGSDCSEHASCLNTDGSYV
CSCIPPYTGDGKTCAEPVKCKAPGNPENGHSFGEIYTVGAEVTFSCEEGHQLMGVTRILC
LESGEWNHPMPYCEAISCGEPAIPENGGVNGLSFTYGSKVTYRCDKGYTLTGDKEASCLA
SGSWSHSPPVCELVKCSNPENINNGKYILSGLTYLSTATYSCEKGYSLQGPSVIECTASG
SWDPTPPACHLVFCGEPPAIKDAVTTGSNFTFGNTVTYTCKEGYTLAGPDTIECLATGKW
SGSNQQCLAVSCDEPPNVEHASPETAHRLFGDIAFYYCSDGYSLADNPQLLCNAQGNWVP
PEGQAMPRCIAHFCEKPPSVSYSILESVSKAKFTAGSVVSFKCMEGFVLNTSAKIECMRG
GQWNPSPMSIQCIPVRCGEPPSIMNGYASGSNYSFGAMVAYSCNKGFYIKGEKKSTCEAT
GQWSSPIPTCHPVSCNEPPKIENGFLEHTTGRIFESEVRFQCNPGYKSVGNPVFVCQANR
HWHSESPLSCVPLNCGKPPPIQNGYMKGENFEVGSKVQFFCNEGYELIGDSSWTCQKSGK
WNKKPNQKCVPAKCPEPPLLENQLVLKELTTEVGVVTFSCKEGHALQGPSVLKCLPSQQW
NDSFPVCKLVFCLPPPLISFGVPAPSSALHFGSTVKYSCVDGFFLRGDPTTFCQADGTWS
SPLPECVPVECPQPEEIVNGIIDVQGLAYLSTALYTCKPGFELVGNTTTLCGENGHWLGG
RPTCKPIECPKPKEILNGKFSYTDLYYGQTITYSCDRGFRLKGPKALTCLETGDWDMDVP
SCNAIHCNPPQPIENGFVEGADYSYGAMIIYSCFPGFQVAGHAMQTCEESGWSSSIPTCV
PIDCGLPPHIDFGDCIKVKDGQGYFDQEDDIMQVPYLTPHPPHHLRAMAKIWENSKESST
THLSNFLYGTIVLYTCNPGYELLGTPMLICQEDGTWNGSAPSCISIECDLPFAPENGFLH
FTETTMGSAVQYSCKPGHLLVGSNIRLCLQNKEWSGASPHCEAISCKKPNPIMNGSIKGS
NYTYLSVLYYECNPGYVLNGTERRTCQENKNWDGTEPICIPVDCGSPPISANGQVVGDVY
TFQKEVEYTCNEGFLLEGARSRICLASGSWSETTPICVPIKCATPPQVANGMMDGLDYDF
GKEVVFHCQEGYVLHGASKLTCQADGNWDAEVPLCKPVNCVSPEDLSHGFPNGFSFYHGG
HIQYQCFPGYKLHGSPSRRCLSNGSWSGSTPSCLPCKCSIPIIQNGAVNGSDFGCGKAAW
IQCFKGFKLLGLSEITCIANGQWSTAFPHCEHIPCGSPPTIPNALISESGSLEKNVITYS
CTPGYVMQGSSNLICTEKGAWSQPYPVCEPLSCGPPPSVANAVATGETYTYESKVKLRCL
EGYVMDTDIDTFTCQKDGHWFPERISCSLKTCALPANITHVLIHGDDFGVNKQISVSCTE
GYTYKGVNISTCQLDGTWEPAFSDESCSPVSCGKPESPEHGLVVGSKYSFESTIIYQCEA
GYELEGNRERVCQENRQWSGGVATCKKTGCDAPLEFLNGKAEVENTTGGLSVAYSCNRGY
SLEGTPEAHCTENGTWSHPVPLCKPNPCPVPFVIPENALLSEKEFYVDQNVSIKCREGFQ
LQGQGTITCNPDETWTQTHAKCEKISCGPPAQVENAIARGVHYQYGDMITYSCYSGYMLE
GSLRSVCLENGTWTSPPICRAVCRFPCQNGGICQRPNACSCPDGWMGRLCEEPICILPCL
NGGRCVAPYQCNCPPGWTGSRCHTAVCQSPCLNGGKCVRPNRCHCLSTWTGHDCSRKRRN
SI
Download sequence
Identical sequences G3TFY5
ENSLAFP00000013340 ENSLAFP00000013340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]