SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013780 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013780
Domain Number 1 Region: 63-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000645
Family EGF-type module 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013780   Gene: ENSLAFG00000016413   Transcript: ENSLAFT00000016414
Sequence length 177
Comment pep:novel supercontig:loxAfr3:scaffold_30:22726525:22745712:1 gene:ENSLAFG00000016413 transcript:ENSLAFT00000016414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YDKASPQAMASSPYLRCRLEGLVILHCVVADVNSTRSPETENLLCEDPGKNCAATTTQSK
RKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCEEGYTGARCERVDLFYLRGDRGQILV
ICLIAVMVIFIILVIGVCTCCHPLRKSRKRRKKEEEMETLGKDITPIDEDIQETNIA
Download sequence
Identical sequences G3TGY5
ENSLAFP00000013780 ENSLAFP00000013780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]