SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013953 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013953
Domain Number 1 Region: 162-263
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.09e-21
Family Synaptotagmin-like (S variant) 0.0058
Further Details:      
 
Domain Number 2 Region: 303-506
Classification Level Classification E-value
Superfamily vWA-like 6.67e-21
Family Integrin A (or I) domain 0.025
Further Details:      
 
Domain Number 3 Region: 25-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.33e-21
Family Synaptotagmin-like (S variant) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013953   Gene: ENSLAFG00000016621   Transcript: ENSLAFT00000016620
Sequence length 558
Comment pep:novel supercontig:loxAfr3:scaffold_57:3726988:3741145:-1 gene:ENSLAFG00000016621 transcript:ENSLAFT00000016620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PASMSARSESEAATAAVPAPCASKVELRLSCRHLLDRDPLTKSDPSVVLLLQSQGQWVQV
DRTEVVRSSLHPVFSKVFTLDYYFEEVQKLRFEVYDTHGPGGLSCPEDDFLGGTECTLGQ
IVAQKKMTRALLLKSGRNAGKSTITVIAEDISGNDGYVELSFRAKKLDDKDLFSKSDPFL
ELYRVNDDQSEQLVYRTEVVKNNLSPVWEPFKVSLNSLCSCEETRPLKCLVWDYDSRGKH
DFIGEFSTTFQEMQKASGRQAQWDCVNAKYKQKRRNYKNSGVVILSHLKVHRVYSFLDYI
MGGCQIHFTVAIDFTASNGDPRNSCSLHYINPYQPNEYLRALVAVGEICQDYDSDKRFSA
LGFGARIPPKYEVSHDFAINFNPDNDECEGIQGVVESYQNCLPKVQLYGPTNVAPIISKV
ARTAAAEERTGEASQYYILLILTDGVVTDMADTREAIVRASHLPMSIIIVGVGNADFTDM
QILDGDDGVLRSPRGEPALRDIVQFVPFRELKNASPSALAKCVLAEVPKQVVEYYSHKEL
PPRGLNTHSQEGGPVLAL
Download sequence
Identical sequences G3THC7
ENSLAFP00000013953 ENSLAFP00000013953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]