SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014191 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLAFP00000014191
Domain Number - Region: 199-240
Classification Level Classification E-value
Superfamily Moesin tail domain 0.000719
Family Moesin tail domain 0.018
Further Details:      
 
Domain Number - Region: 97-177
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 0.0294
Family NadC C-terminal domain-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014191   Gene: ENSLAFG00000016926   Transcript: ENSLAFT00000016928
Sequence length 390
Comment pep:novel supercontig:loxAfr3:scaffold_16:42867084:42910643:1 gene:ENSLAFG00000016926 transcript:ENSLAFT00000016928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERASRSIHQLKCALREGDGTVGEDTLDPSYSTSAGNDDTGAAWHELQHSHAVNQLKALLH
RQAAKESEISPSRRRKMSPLSSSTDEENDVPTLHNLVPIINDQSQYIHHLEAEVKFCKEE
LSGMKNRIQVVVLENDRLQQELKSQRGEETMREQTLLDASGNMQNSWITTGEDAGVDEAA
KRPLSQCNADPVKAASAAEAERWKVELERLKLIYMDKSEILESQLMFLRKDLAEYQKKCE
DLQERLKHKESLLAANISNRVGGLCLKCAQHEAVLSQTHNNVHIQTIERLTKERDDLMAA
LVSVRSSLTDVQQREASAYEQVKQAVLMTEEANFEKTKALIQCEQLKNELERQSERLEKE
LASQQEKRAFEKEMMKKERTKEREDMEAKV
Download sequence
Identical sequences G3THW0
ENSLAFP00000014191 ENSLAFP00000014191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]