SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014218 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014218
Domain Number 1 Region: 76-112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000864
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 2 Region: 163-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000327
Family LDL receptor-like module 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000014218
Domain Number - Region: 128-157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000102
Family LDL receptor-like module 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014218   Gene: ENSLAFG00000016962   Transcript: ENSLAFT00000016961
Sequence length 206
Comment pep:novel supercontig:loxAfr3:scaffold_17:42617353:42626311:1 gene:ENSLAFG00000016962 transcript:ENSLAFT00000016961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKIFPQGDVNGNVATETKALPGGKADCGHLCCSRQGACLSASILLLLATLAALIVLVVI
YGLPPRTPGTRACVTPTNRTGFLCHDRKTCIPASGVCDGVRTCVHGEDEDEGLCRDVPQS
LPSFLVAHCGDPAFWIYSDQKCDGINSCGDCSDELSQVTLCPSCGPGWWRCTPTVFRYCE
CIPRSLCQDHVQHCSDWSDEYSCPGL
Download sequence
Identical sequences G3THY3
ENSLAFP00000014218 ENSLAFP00000014218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]