SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014229 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014229
Domain Number 1 Region: 566-654
Classification Level Classification E-value
Superfamily PH domain-like 7.74e-20
Family Third domain of FERM 0.0049
Further Details:      
 
Domain Number 2 Region: 380-473
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-17
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 3 Region: 285-338,509-565
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000977
Family Second domain of FERM 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000014229
Domain Number - Region: 26-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0339
Family Ubiquitin-related 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014229   Gene: ENSLAFG00000016969   Transcript: ENSLAFT00000016972
Sequence length 677
Comment pep:novel supercontig:loxAfr3:scaffold_19:24104609:24150490:1 gene:ENSLAFG00000016969 transcript:ENSLAFT00000016972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSSDFASASWELVVRVDRPNEEEQRDVTLRVSGDLHIGGVMLKLVEQMNISQDWSDFA
LWWEQKHCWLLKTHWTLDKCGVQADAKLLFTPQHKTLRLRLPNVKTVRLRVSFSAVVFKA
VSDICRTLNIRRPEELSLLKPSGDYFKKKKKKDKNNKEPVTEDILNLESSPTASGSPVSP
GLYSKTMTPVYDPVSGTPASSTMTWFSDSPLTEQNCSVLAFSQPTQSPEALADMYQPRSL
VDKAKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYTFFDLNPKYDAVRINQLYEQARWAI
LLEEIDCTEEEMLIFAALQYHISKLSLSTEIQDFTNETEADEVEAALSNLEVTLEGGKTD
NTLEDITDIPKLADNLKLFRPKKLILKAFKQYWFVFKDTSIAYFKNKELEQGEPVEKLNL
RGCEVVPDVNVAGRKFGIKLLIPVADGMNEVYLKCDHENQYARWMAACILASKGKTMADS
SYQPEVLSILSLLRMKNRSSASPTASSVESMDMNPECFVSPRCAKKHKAKQLAARILEAH
QNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIRIDAATGIP
ITTWRFTNMKQWNVNWEIRQVAIEFDQNVSIAFTCLSADCKVVHEYIGGYIFLSTRSKDQ
NETLDEDLFHKLTGGQE
Download sequence
Identical sequences G3THZ2
XP_003411606.1.64505 ENSLAFP00000014229 ENSLAFP00000014229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]