SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014231 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014231
Domain Number 1 Region: 40-147
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.11e-27
Family Pyk2-associated protein beta ARF-GAP domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014231   Gene: ENSLAFG00000016974   Transcript: ENSLAFT00000016974
Sequence length 492
Comment pep:novel supercontig:loxAfr3:scaffold_152:338505:361171:-1 gene:ENSLAFG00000016974 transcript:ENSLAFT00000016974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMAAKKGPGPGGGVGGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECSQRGVTYVDI
TVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTS
LVPDSRDPQKVKEFLQEKYEKKRWYVPPDQVKGPTYTKGSASTPVQGSIPEGKPLRTLLG
DPVPSLSAAASTSNQSVSQTQARLSQPRSSQAPPHSSVKKASTDLLADIGGDPFAAPQAA
PAFAAFPAFGVGQTPSHGGFANFDAFGSSSSSSTFGNVPPVGQAPFQPQPTLPASRMLTG
SYSFGSSQVTPFGVSPLAPASQPNSLTDMGSILGPGVSAGGISPHSVFGVASPAPALQSA
TAGGSGSTGLTFGAFTNPFTAPAAHPPLLSTNPFQPNGLAAGPGFGMSSAGPGFPQTVPP
MGGFASSFSPPVFPPQTSMTQQQNGSSFGDLGSAKPGQRPLGQPAGISTNPFMTGSAATP
FASKPPATNPFL
Download sequence
Identical sequences G3THZ4
ENSLAFP00000014231 ENSLAFP00000014231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]