SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Loxodonta africana 69_3 > ENSLAFP00000014277

Domain assignment for ENSLAFP00000014277 from Loxodonta africana 69_3

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSLAFP00000014277
Domain Number 1	Region: 29-65
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000000157
Family	LDL receptor-like module	0.001
Further Details:

Domain Number 2	Region: 110-147
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000144
Family	LDL receptor-like module	0.0011
Further Details:

Domain Number 3	Region: 70-107
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000445
Family	LDL receptor-like module	0.0015
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSLAFP00000014277 Gene: ENSLAFG00000017028 Transcript: ENSLAFT00000017031
Sequence length	345
Comment	pep:novel supercontig:loxAfr3:scaffold_21:13291047:13589303:-1 gene:ENSLAFG00000017028 transcript:ENSLAFT00000017031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MWLLGPLCLLLSSAAESQLLPGNNFTNECNIPGNFMCSNGRCIPGSWQCDGLPDCFDKSD EKECPKAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARFHC KNGLCIDKSFICDGQNNCQDNSDEESCESSQEPGSGQVFVTSENQLVYYPSITYAIIGSS VIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGIQ YVASQAEQNASEVGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSA NSASSQAPSSLLSMEDTGHSLGQPGPPEGTVEPRDSLPSQGIEEV
Download sequence
Identical sequences	G3TI29 ENSLAFP00000014277 XP_010590426.1.64505 ENSLAFP00000014277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]