SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014282 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014282
Domain Number 1 Region: 230-406
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-62
Family SPRY domain 0.00000697
Further Details:      
 
Domain Number 2 Region: 37-98
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.04e-17
Family B-box zinc-binding domain 0.00098
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000014282
Domain Number - Region: 3-33
Classification Level Classification E-value
Superfamily RING/U-box 0.00971
Family RING finger domain, C3HC4 0.086
Further Details:      
 
Domain Number - Region: 82-175
Classification Level Classification E-value
Superfamily OmpH-like 0.0131
Family OmpH-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014282   Gene: ENSLAFG00000017039   Transcript: ENSLAFT00000017037
Sequence length 407
Comment pep:novel supercontig:loxAfr3:scaffold_110:2166247:2193139:1 gene:ENSLAFG00000017039 transcript:ENSLAFT00000017037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGSFPCPECREMSPQRNLRPNRLLTKVAEMARQHPSLQKRDLCKTHQELLKLFCQEDQSP
ICVICRESREHRLHTVFPIDEAIQDYKAKLEENMEYLREEMMKTEEALAREDQTMKEWQK
MIESQRQNVLAEFERLRRFLVEEEQQLLQKLEEEELEVLPRLRENAARLVQQSAALGGLI
AELEGRCQLPALGLLQDIRDALRRIQDVKLQPPEVVPMELRTVCRVPGLVETLRRFRGDV
ILDPETANPELVLSEDRRSVRRGDLRQALPDSPERFDPGPCVLGHLRFTTGRHYWEVEVG
ERANWALGVCRENVNRKETGELSAGNGFWILVFLGSYYNSPERAFVPLRDPPRRVGIFLD
YEAGHLSFYSVTDGSLLFIFPETSFSGTLRPLFSPLSSSPTPLTICR
Download sequence
Identical sequences G3TI32
ENSLAFP00000014282 ENSLAFP00000014282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]