SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014312 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014312
Domain Number 1 Region: 37-173
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-37
Family C-type lectin domain 0.00000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014312   Gene: ENSLAFG00000017076   Transcript: ENSLAFT00000017073
Sequence length 175
Comment pep:novel supercontig:loxAfr3:scaffold_27:31588966:31591150:-1 gene:ENSLAFG00000017076 transcript:ENSLAFT00000017073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCPMALSSTSWMLLSCLFLLSQVQGEDTSKEDRSARISCPRGSKAYGSYCYALFTTPKT
WVDADMACQKRSSGHLVSVLSEPEAYFVGSLVKSISSSYTNIWIGLHDPTLGSELDAGGW
EWSSTDLMNYFAWERNPSTVTNPGYCGTVSRNTGFLKWKDYNCEQRLPYVCKFKN
Download sequence
Identical sequences G3TI57
ENSLAFP00000014312 ENSLAFP00000014312 XP_003413755.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]