SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014418 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014418
Domain Number 1 Region: 22-187
Classification Level Classification E-value
Superfamily RUN domain-like 1.44e-32
Family RUN domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014418   Gene: ENSLAFG00000017195   Transcript: ENSLAFT00000017194
Sequence length 957
Comment pep:novel supercontig:loxAfr3:scaffold_25:18159076:18215988:-1 gene:ENSLAFG00000017195 transcript:ENSLAFT00000017194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPEGSGMELDGCGERLPEESRREHWQLLGNLKTTVEGLVSTNSPNVWSKYGGLERLCRD
MQSILYHGLIHDQVCCGQTDYWQFVKDIRWLSPHSALHVEKFISLHENSQSSTDDVSERA
IAELWLQHSLRCHCLSAQLRPLLGDRQYIRKFYTDTAFLLSDAHVTAMLQCLEAVEQNNP
RLLAQIDASMFARKHESPLLVTKSQSLTALPGSTYTPPTSYTQHSYFGSFSSLHQSMLNH
GKGVPERKSSFSLSGPSRKPQENRGHVSLAEDQPVQASLLSISALARDSPISPNEMSSST
LTSPVEASWVSSQNESPSDASEGPEYLAIGNQDPRSRTASCQSQSSNTESSGFNLFSSSS
SQKPDSAASSLGDQEGDGQSQLSSVLRRSSYSEGQTLTVTSGTKKNHTRSHSDTNIISSG
AAGGPRNITIIVEDPIAEGGQYLCSGEGMFRQPSEGQSLISYLSEQDFGSCADLEKENAH
FSISESLIAAIELMKCNMMSQCLQEEEEEEEDSDREIQELKQKIRLRRQQIRTKNLFPGY
QEAEHGSFWVTSSSSQFSSRDSTQFSDSGSADEVDELEIQDADIRRNTASNSKPCMSSQS
LSHCFLHSTSAEAVAMGLLKQFEGMQLPAASELEWLVPEHDAPQKLLPIPDSLPISPDDG
QHADIYKLRIRVRGNLEWAPPRPQIIFNVHPAPARKIAVAKQNYRCAGCGIRTDPDYIKR
LRHCEYLGKYFCQCCHENAQMIIPSRVLRKWDFSKYYVSNFSKDLLSKIWNDPLFNVQDI
NSALYRKVKLLNQVRLLRVQLYHMKNMFKTCRLAKELLDSFDTVPGHLTEDLHLYSLNDL
AATRKGELGPRLAELTRAGATHVNRCMLCQAKGFICEFCQNEDDIIFPFELHKCRTCEEC
KACYHKACFKSGSCPRCERLQARRELLAKQSLESYLSDYEEEPTEALALEATSLETT
Download sequence
Identical sequences G3TIE4
ENSLAFP00000014418 ENSLAFP00000014418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]