SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014469 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014469
Domain Number 1 Region: 199-323
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-42
Family Third domain of FERM 0.000000348
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-38
Family Second domain of FERM 0.000000594
Further Details:      
 
Domain Number 3 Region: 491-578
Classification Level Classification E-value
Superfamily Moesin tail domain 4.71e-33
Family Moesin tail domain 0.0000039
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-24
Family First domain of FERM 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014469   Gene: ENSLAFG00000017262   Transcript: ENSLAFT00000017256
Sequence length 578
Comment pep:novel supercontig:loxAfr3:scaffold_24:41564552:41586656:1 gene:ENSLAFG00000017262 transcript:ENSLAFT00000017256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPQHINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWLFGLQYQDTKGFSTWLK
LNRSVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHR
GMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERWVLQNWSGDQGWGKKKNITEIEGKLTELDLKNNREEECGR
EAQQELEEQTRRALELEQERKRAQNEAEKLAKERQEAEEAKEALLQASQDQKKTQEQLAL
EMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENE
QDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKT
ANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
Download sequence
Identical sequences G3U5Q0
ENSLAFP00000014469 ENSLAFP00000023158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]