SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014839 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014839
Domain Number 1 Region: 168-229
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-19
Family C-type lectin domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014839   Gene: ENSLAFG00000017694   Transcript: ENSLAFT00000017694
Sequence length 234
Comment pep:novel supercontig:loxAfr3:scaffold_26:28620912:28628112:-1 gene:ENSLAFG00000017694 transcript:ENSLAFT00000017694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDEDDDYENMTPPYKDLPPKPGSMAPPRPPRAVKKMKSPSILCKPQKMAGLDLTPISCTY
PQQGVELEPPPSRPPPATTPVPYLSQKPGSPGRCWEDRLMVWLCALVVVSLLLGCISLAV
TLTKYQAVVEELRMLTFQQMAWQANVTGMAGLAGLKKDTDRLRADTNQSLVELRGLLGCT
RVTCPDGWLPFEGKCYYFSQVTKSWEEARKFCQENYSHLVIISSFAEQRLRGFS
Download sequence
Identical sequences G3TJD7
ENSLAFP00000014839 ENSLAFP00000014839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]