SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014864 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014864
Domain Number 1 Region: 318-477
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.11e-58
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000193
Further Details:      
 
Domain Number 2 Region: 156-316
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000407
Further Details:      
 
Domain Number 3 Region: 119-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000629
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 4 Region: 76-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000325
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 24-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000378
Family EGF-type module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014864   Gene: ENSLAFG00000017730   Transcript: ENSLAFT00000017729
Sequence length 480
Comment pep:novel supercontig:loxAfr3:scaffold_7:87839281:88362496:-1 gene:ENSLAFG00000017730 transcript:ENSLAFT00000017729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRSVAAWLLVGLSLCAPQCCKGDICDPNPCANGGICLPGLADDSFSCECPDGFTDPNCS
SVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPQGFNGIHCQHNI
NECEAQPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTH
RALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSP
EYIKSYKIAYSNDGKTWSMYKVKGTNEDMVFRGNVDNNTPYANSFTPPIKAQYVRLHPQM
CRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSVFRTLNMDMFTWEPRKARLDK
QGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT
VYQDEKQRKDKVFQGNFDNDTHRKNVISPPIYARYIRILPWSWYGRITLRSELLGCTEEE
Download sequence
Identical sequences G3TJG1
XP_010586560.1.64505 ENSLAFP00000014864 ENSLAFP00000014864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]