SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014888 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014888
Domain Number 1 Region: 34-98
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000208
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 2 Region: 141-222
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000936
Family Calmodulin-like 0.04
Further Details:      
 
Domain Number 3 Region: 228-270
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000282
Family VWC domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014888   Gene: ENSLAFG00000017756   Transcript: ENSLAFT00000017755
Sequence length 308
Comment pep:novel supercontig:loxAfr3:scaffold_25:24403805:24462928:1 gene:ENSLAFG00000017756 transcript:ENSLAFT00000017755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKRWLALALALVAVAWVHAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKP
HKRPVCGSNGKTYLNHCELHRDACLTGSKIQVNYDGHCKEKKHISPSASPVVCYQSNRDE
LRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSHLDSSEFLKFVEQNETAIN
ISTYVDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETY
ADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGSQTHTEEGMTRYVQELQKHQETAEKT
KRVSTKEI
Download sequence
Identical sequences G3TJI1
ENSLAFP00000014888 XP_010591233.1.64505 ENSLAFP00000014888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]