SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000015023 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000015023
Domain Number 1 Region: 153-301
Classification Level Classification E-value
Superfamily EF-hand 6.27e-53
Family Osteonectin 0.0000000858
Further Details:      
 
Domain Number 2 Region: 95-150
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000152
Family Ovomucoid domain III-like 0.0000355
Further Details:      
 
Domain Number 3 Region: 70-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000122
Family Follistatin (FS) module N-terminal domain, FS-N 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000015023   Gene: ENSLAFG00000017920   Transcript: ENSLAFT00000017920
Sequence length 303
Comment pep:novel supercontig:loxAfr3:scaffold_1:71683077:71693326:-1 gene:ENSLAFG00000017920 transcript:ENSLAFT00000017920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWIFFILCLAGRALAVPQQEALPDETEVVEETVAEVAEVPVGANPVQVEVGEFDEGAE
ETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFD
SSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYE
RDENNNLLTEKQKLKVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQ
HPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKEQDIDKD
LVI
Download sequence
Identical sequences G3TJT8
ENSLAFP00000015023 ENSLAFP00000015023 XP_003404661.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]