SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000015422 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000015422
Domain Number 1 Region: 63-190
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-32
Family C-type lectin domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000015422   Gene: ENSLAFG00000018406   Transcript: ENSLAFT00000018404
Sequence length 191
Comment pep:novel supercontig:loxAfr3:scaffold_83:1400377:1410851:1 gene:ENSLAFG00000018406 transcript:ENSLAFT00000018404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWCTIISVLIVVVLKVVGMTLFLLHFPQISGKSNFSFIPTESYGTGMVRHIMVVGRWED
QRRFTPTGSSGTVCPAGWDLHQGKCFLLSIFESPWNKSRSFCKAEGSTLAIVNTPEKLKF
LQDIAGAEMYFIGLTYQPAEKRWRWINNYEFNGNVTNYRQNFNCATIGLTKTFDAAFCDI
NHRWICEKNAK
Download sequence
Identical sequences G3TKQ7
ENSLAFP00000015422 ENSLAFP00000015422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]