SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000015430 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000015430
Domain Number 1 Region: 131-325
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.87e-59
Family Astacin 0.0000938
Further Details:      
 
Domain Number 2 Region: 753-864
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-38
Family Spermadhesin, CUB domain 0.00016
Further Details:      
 
Domain Number 3 Region: 448-551
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-37
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 4 Region: 598-708
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-36
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 5 Region: 332-441
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-36
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 6 Region: 889-982
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-30
Family Spermadhesin, CUB domain 0.00033
Further Details:      
 
Domain Number 7 Region: 554-596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000315
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 706-750
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000023
Family EGF-type module 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000015430   Gene: ENSLAFG00000018416   Transcript: ENSLAFT00000018412
Sequence length 993
Comment pep:novel supercontig:loxAfr3:scaffold_22:14430913:14433222:-1 gene:ENSLAFG00000018416 transcript:ENSLAFT00000018412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPGRKTKGVPLLSPDTPSVLLLPRPGRPLDLADYTYDLGEEDDWEPLNYKDPCKAAAFLG
DIALDEEDLRAFQVQQAADLRQRAIHRSSIKASGNSSIPNCQSASGQPQRKPRRRWRGRS
RSRSRRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDS
YIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDRHV
SIIRENIQPGQEYNFLKMEFQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNG
VKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISV
TPGEKIILNFTSMDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGGKLPEPIVSTDSRLWV
EFRSSSNWVGKGFFAVYEAICGGDVKKDNGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVG
LTFQSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGS
INKAGFAVNFFKAEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGG
FLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRS
GLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGG
CQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKEC
TWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVYDGRDAKAPVLGRFCGSKKPEAVLAT
SNRMFLRFFSDNSVQRKGFQASHSTECGGQVRAEVKTKDLYSHAQFGDNNYPGGVDCEWV
IVAEEGYGVGLVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDS
VLVKFHSDDTITKKGFHLRYTSTKFQDTLHSRK
Download sequence
Identical sequences G3TKR9
ENSLAFP00000015430 ENSLAFP00000015436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]