SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000015537 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000015537
Domain Number 1 Region: 143-251
Classification Level Classification E-value
Superfamily Immunoglobulin 2e-17
Family I set domains 0.042
Further Details:      
 
Domain Number 2 Region: 34-108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000596
Family Growth factor receptor domain 0.0028
Further Details:      
 
Domain Number 3 Region: 95-140
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000097
Family Ovomucoid domain III-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000015537   Gene: ENSLAFG00000018534   Transcript: ENSLAFT00000018534
Sequence length 266
Comment pep:novel supercontig:loxAfr3:scaffold_6:61920876:61935170:1 gene:ENSLAFG00000018534 transcript:ENSLAFT00000018534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMPRSPVPFLLLLLLLPPLAVGLGLHGAGGRRPECGPCGPERCPAPARCPAPWMSALDEC
SCCARCLGAEGASCGGRAGARCGSGLVVREGTGLCVCAQRGVVCGSDGRSYPSVCALRVR
ARHGPHAHLGHLHKVRDGPCEFAPVVIIPPQSVHNVTGAQVYLSCEVRAVPAPVITWRKV
TQSPEGTQVLEELPGDHVNIAVQVRGGPSDHETTTWIIINPLRKEDEGVYQCHSANTVGE
AQSHGTVTITELTHVVSLSPGPALVA
Download sequence
Identical sequences G3TL04
ENSLAFP00000015537 ENSLAFP00000015537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]