SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000015620 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000015620
Domain Number 1 Region: 133-281
Classification Level Classification E-value
Superfamily C-type lectin-like 2.23e-43
Family C-type lectin domain 0.000000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000015620   Gene: ENSLAFG00000018633   Transcript: ENSLAFT00000018633
Sequence length 286
Comment pep:novel supercontig:loxAfr3:scaffold_47:11118727:11122008:-1 gene:ENSLAFG00000018633 transcript:ENSLAFT00000018633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKEYQDLQHLDNEDSDHLPQLRQGLPPPQPLLRRLCSGPCLLLLSLGLSLLLLIIICVI
GSRNSQLQKELQVLRGTFSNFTASTEAEVKALSTQGDGVGRKMKSLESQLLKQQQSMGED
HSNLLLHVKHFVSDLRSLSCQMAMLLGNGTERPCCPVNWVEYEGSCYWFSRSGKSWPEAQ
KYCQLEDAHLVVVTSWQEQNFIQHHTGSVNTWIGLTDKNGPWKWVDGTDYETGFKNWSPE
QPDDWYGHGLGGGEDCAHFTDNGRWNDDVCQRPYRWVCETGLDKAS
Download sequence
Identical sequences G3TL72
XP_010594856.1.64505 ENSLAFP00000015620 ENSLAFP00000015620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]