SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000015826 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000015826
Domain Number 1 Region: 102-147
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000349
Family C-type lectin domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000015826   Gene: ENSLAFG00000020825   Transcript: ENSLAFT00000020847
Sequence length 161
Comment pep:novel supercontig:loxAfr3:scaffold_251:106854:108768:-1 gene:ENSLAFG00000020825 transcript:ENSLAFT00000020847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNQTVIYSDINLAKYPKRQQIKPESKNSSISDTEQDITYVELNLHNASQDLQGNDKKPH
CKVFPSPPARLAAMTLGIICLVLMASVLITTVVVITADTVKPGQNNSSLITRTQKVCEGH
CHHCPKAWFMYSNRCYYISNERKSWSEVEWPVLLMHLICFT
Download sequence
Identical sequences G3TLL7
ENSLAFP00000015826 ENSLAFP00000015826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]